SecReT6
Protein ID: 529988764
SecReT6 ID806
T6SS typeN/A
Gene symbol-
Locus tagKPR_3174
StrainKlebsiella pneumoniae subsp. rhinoscleromatis strain SB3432
Repliconchromosome [GenBank: NC_021232] [Browse all T6SS(s) in this replicon]
Location [Strand]3253685..3253948 [-]
Producthypothetical protein
NotePAAR
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.10E-25, Aligned region: 5..80
DUF4150 [PF13665], Evalue: 0.0017, Aligned region: 9..38
DUF4150 [PF13665], Evalue: 0.0017, Aligned region: 47..56
Protein Sequence: 87 a.a.     [Download]
>gi|529988764|ref|YP_007992150.1| unnamed protein product [Klebsiella pneumoniae]
MKGIIRTGDTHTGGGKVLSGSSNMKFGGIGVARLGDLVSCPIKGHGPTVIAEGHPTFSDHGIPVAFHGHR
CACGCVLLSSLPQARVR
 
Nucleotide Sequence: 264 bp     [Download]
>gi|529985600|ref|NC_021232.1|:c3253948-3253685 Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome
ATGAAAGGAATTATTCGTACAGGCGATACGCATACCGGGGGCGGGAAAGTGCTCAGTGGTTCCAGTAATA
TGAAATTTGGTGGTATCGGCGTGGCGCGGCTGGGCGATCTCGTCAGTTGTCCGATCAAAGGCCATGGTCC
GACGGTGATTGCCGAAGGGCATCCCACTTTTAGCGATCATGGCATACCGGTTGCGTTCCATGGCCACCGT
TGTGCGTGTGGTTGTGTATTGCTGTCGAGCCTGCCACAAGCCAGGGTGCGCTAA
 Primer design