SecReT6
Protein ID: 529988772
SecReT6 ID806
T6SS typeN/A
Gene symbol-
Locus tagKPR_3182
StrainKlebsiella pneumoniae subsp. rhinoscleromatis strain SB3432
Repliconchromosome [GenBank: NC_021232] [Browse all T6SS(s) in this replicon]
Location [Strand]3261002..3262699 [-]
Producthypothetical protein
NoteTagL
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 4.00E-17, Aligned region: 435..531
Protein Sequence: 565 a.a.     [Download]
>gi|529988772|ref|YP_007992158.1| unnamed protein product [Klebsiella pneumoniae]
MRDNARRLLTILTVILALWLVLGFWPLSIGNQVIFSLCILLAAGAALWRQRRRAVSRQRSEIVLPPEDFQ
GAVVLVCGDTDGLFPGRSAHGETRHGWYLRGDSAEQLPRLAQYLAAARPALVSQVSVLLAVVPEHHPSGE
HLAQSLRDWRRSIVQCRTWLNGLPPVWSVFWVTPPGGQAVESRWFTITPERAGLQVQQKGQAPQSVAGWQ
REGSSASRLHQTLWLESILTLAENALFRPFRARQAELPPLNLCAAGICLTPVAAVANNLWQQQIAGITTL
SPGNAAAPGPHPLPDLLLSSLPHRHGVSRRMRDVGLAAGVGFLFLALAMLASFINNQRLVRSVGDHLAVY
HRLSGTPPTPKLQAQQRLRADSRLLDDWLRRGEPLRYRLGLYQGGRLIPFVEAAINDWAPPPPPRPVIKQ
VVQGPQTIRLDSMALFDTGKSALKPGSTKLLVNSLLGIKVKPGWLIVVAGHTDSIGNDRSNQQLSLKRAE
AVRDWMRDTGDVPESCFAVQGYGASRPVASNETPEGRAQNRRVEISLVPQKDACLTPGTANTSGAETNGL
KSETE
 
Nucleotide Sequence: 1698 bp     [Download]
>gi|529985600|ref|NC_021232.1|:c3262699-3261002 Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome
ATGCGTGATAACGCCCGTCGTCTGCTTACGATACTGACCGTCATCCTGGCCCTGTGGCTGGTGCTGGGCT
TCTGGCCGCTGTCCATCGGCAACCAGGTGATCTTCAGTCTGTGCATCCTGCTGGCGGCCGGCGCGGCGCT
CTGGCGTCAGCGTCGCCGGGCAGTCAGCCGTCAGCGATCGGAAATCGTCCTGCCGCCCGAGGATTTTCAG
GGGGCAGTGGTTCTGGTCTGCGGGGATACCGACGGTCTGTTTCCCGGGCGTTCGGCGCACGGCGAAACCC
GTCACGGCTGGTATCTACGGGGAGACAGCGCGGAGCAATTGCCGCGGCTGGCGCAGTACCTGGCGGCGGC
GCGTCCGGCGCTGGTATCGCAGGTTTCCGTGCTGCTGGCGGTGGTACCGGAGCACCACCCCTCCGGGGAG
CATCTGGCGCAGTCGCTGCGCGACTGGCGGCGGAGTATCGTTCAGTGCCGAACCTGGCTAAACGGTCTGC
CGCCGGTGTGGAGCGTGTTCTGGGTGACGCCGCCAGGCGGCCAGGCCGTGGAAAGCCGCTGGTTTACCAT
CACGCCGGAGAGGGCTGGTCTCCAGGTGCAGCAGAAGGGACAAGCGCCCCAGTCGGTTGCCGGGTGGCAG
CGGGAGGGCAGCTCTGCCTCACGCCTGCATCAGACGCTGTGGCTGGAGAGCATTCTGACCTTGGCCGAAA
ACGCTCTTTTCCGGCCATTCCGCGCCCGGCAGGCAGAACTTCCTCCGCTGAACCTGTGTGCCGCGGGCAT
CTGCCTTACGCCGGTGGCGGCGGTGGCGAATAACCTCTGGCAACAGCAAATCGCCGGGATCACCACGCTC
TCCCCGGGCAACGCCGCGGCGCCAGGTCCTCACCCGCTGCCGGATCTTCTTCTGTCGTCGCTGCCGCACC
GCCACGGGGTCAGCCGTCGGATGCGCGATGTTGGTCTTGCCGCTGGGGTGGGCTTCCTCTTTCTGGCGCT
GGCGATGCTGGCTTCCTTTATCAACAACCAGCGCCTGGTGCGCAGCGTCGGCGATCATCTGGCGGTGTAT
CACCGCCTCAGCGGCACGCCGCCGACGCCGAAGCTGCAGGCGCAGCAGCGTCTGCGTGCCGACAGCCGCC
TGCTGGATGACTGGTTGCGCCGGGGGGAGCCGCTGCGTTATCGGCTGGGGCTGTATCAGGGGGGGCGGCT
GATCCCCTTCGTGGAAGCCGCTATCAATGACTGGGCGCCGCCCCCGCCGCCGCGTCCGGTCATTAAGCAG
GTTGTGCAGGGGCCGCAGACGATCCGCCTCGATAGCATGGCGCTGTTCGATACCGGCAAATCGGCGCTGA
AACCGGGTTCGACAAAGCTGCTGGTGAACTCGCTGCTGGGCATTAAGGTGAAACCCGGCTGGCTGATCGT
GGTGGCAGGCCATACCGACAGCATCGGCAACGATAGATCCAATCAACAACTCTCCCTGAAGCGTGCCGAG
GCGGTCCGCGACTGGATGCGCGATACCGGCGATGTGCCGGAGAGCTGTTTTGCGGTGCAGGGCTACGGCG
CAAGCCGTCCTGTCGCCAGCAACGAGACGCCAGAGGGGCGGGCGCAAAATCGCCGGGTGGAGATCAGTCT
GGTCCCGCAGAAGGACGCCTGTCTGACGCCGGGCACGGCCAATACCTCAGGAGCAGAGACTAACGGATTA
AAAAGCGAAACCGAGTAA
 Primer design