SecReT6
Protein ID: 529988773
SecReT6 ID806
T6SS typeN/A
Gene symbol-
Locus tagKPR_3183
StrainKlebsiella pneumoniae subsp. rhinoscleromatis strain SB3432
Repliconchromosome [GenBank: NC_021232] [Browse all T6SS(s) in this replicon]
Location [Strand]3262703..3263302 [-]
Producthypothetical protein
NoteTssL
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.80E-41, Aligned region: 10..199
Protein Sequence: 199 a.a.     [Download]
>gi|529988773|ref|YP_007992159.1| unnamed protein product [Klebsiella pneumoniae]
MNISESDLINKTFYPGWLMVSQLRCGQPVTDGEALYRQACRWVTEAREALTAGGVSEASAEQMLYAYCAL
LDESVLNRASQDDGYRRWRKDPLQARFFSTLNAGEELWERIRQLLREPTADAAVLTCFYRTLQLGFVGQY
RAEDDERREDVAQALGARVPPFSMTQEAPVVVRASRLRSGRRMYWCGWAAGIVALAALW
 
Nucleotide Sequence: 600 bp     [Download]
>gi|529985600|ref|NC_021232.1|:c3263302-3262703 Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome
ATGGTCAGCCAGTTACGCTGCGGCCAGCCGGTGACCGATGGCGAGGCGCTCTATCGCCAGGCCTGTCGAT
GGGTGACCGAGGCGCGCGAGGCGCTGACGGCGGGGGGAGTCAGTGAAGCAAGCGCTGAGCAGATGCTCTA
TGCCTACTGCGCGCTGCTGGATGAGAGCGTCCTCAACCGCGCCAGTCAGGATGATGGCTACCGCAGGTGG
CGCAAGGATCCGCTGCAGGCGCGCTTTTTCAGCACTCTCAACGCCGGGGAAGAGCTCTGGGAACGGATCC
GCCAGCTGCTGCGAGAGCCCACGGCGGATGCGGCAGTGCTGACTTGTTTCTATCGTACTTTGCAACTGGG
GTTTGTCGGACAGTACCGCGCCGAGGATGACGAACGGCGTGAGGACGTGGCGCAAGCGCTTGGCGCGCGG
GTCCCGCCGTTCAGCATGACCCAGGAGGCGCCGGTGGTGGTTCGTGCCTCCCGGCTGCGCAGCGGACGGC
GGATGTACTGGTGCGGCTGGGCGGCCGGCATTGTGGCGCTGGCGGCGCTGTGGTTGACCTGCTCCGCCAT
GCTGTCACAGATGGTGGCGCAGATAGCAGGGCAGGGATAA
 Primer design