SecReT6
Protein ID: 529988774
SecReT6 ID806
T6SS typeN/A
Gene symbol-
Locus tagKPR_3184
StrainKlebsiella pneumoniae subsp. rhinoscleromatis strain SB3432
Repliconchromosome [GenBank: NC_021232] [Browse all T6SS(s) in this replicon]
Location [Strand]3263353..3264693 [-]
Producthypothetical protein
NoteTssK
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.70E-131, Aligned region: 18..443
Protein Sequence: 446 a.a.     [Download]
>gi|529988774|ref|YP_007992160.1| unnamed protein product [Klebsiella pneumoniae]
MKIFRPLWRDGAFLVPQQFQQQARWDAHVADTVSRMALAHPWGVLRAEFDASALTLSRLNATRLIVRFAD
GTLIDTELADILPPVRDVSDVMQDSVEVLLALPLLSASGGNLDDGQESARPRRWRAEQVTVQELAGHERS
ELAVLRHALTLRLSTEENAAFLTCPVARLVRDAQGQWIVDPEFIPPLLSLAASPTLVSELGELLHRLQAR
RRRLMAMRRESNARMADFAVADVSLFWLLNALNSAEPVLSELHQDPSRHPELLYRELARLAGSLLTFSLE
HHLEAIPRYRHASPEQVFPPLFALLDTLLEVSLPSRVIAIALEQGADREIWRGRLHDARLREGADFYLSV
RSSLPPHQLQSRFPQLCKAGSHDDVAEVVNIALSGIAIKPLSHVPAAIPLRLENQYFALDLSTDAARAML
EAGNCTFYTPESLGDVKLELFAVLRS
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|529985600|ref|NC_021232.1|:c3264693-3263353 Klebsiella pneumoniae subsp. rhinoscleromatis strain SB3432, complete genome
ATGAAGATTTTCCGCCCATTATGGCGCGACGGGGCTTTTCTGGTCCCGCAGCAGTTTCAGCAACAGGCCC
GCTGGGACGCGCACGTCGCCGATACGGTCTCCCGCATGGCGCTCGCCCACCCGTGGGGGGTATTGCGCGC
GGAGTTTGACGCGAGCGCGCTCACCCTTTCCCGGCTCAACGCTACCCGGCTGATCGTGCGTTTCGCCGAC
GGAACGCTGATTGACACCGAGCTGGCGGATATTTTGCCACCGGTCCGCGATGTATCGGACGTGATGCAGG
ACAGCGTGGAGGTTCTGCTCGCTCTGCCGCTGCTCAGCGCCAGCGGCGGCAATCTTGATGACGGCCAGGA
GAGCGCCCGCCCGCGCCGCTGGCGCGCCGAGCAGGTGACCGTCCAGGAGCTGGCCGGCCATGAACGCAGC
GAGCTGGCCGTTCTGCGGCACGCGCTAACGCTGCGTCTCTCCACCGAGGAAAATGCAGCCTTCCTCACCT
GCCCGGTAGCGCGTCTGGTGCGCGACGCCCAGGGGCAGTGGATCGTTGACCCGGAATTCATCCCGCCGCT
GCTGTCGCTGGCGGCAAGCCCGACGCTGGTCAGCGAGCTGGGCGAGCTGTTACATCGCCTGCAGGCCCGA
CGCAGACGCCTGATGGCCATGCGTCGTGAAAGCAATGCGCGGATGGCTGATTTTGCCGTGGCGGATGTTT
CCCTGTTCTGGCTGCTCAACGCGCTGAACAGCGCTGAACCGGTGCTCAGCGAGCTGCATCAGGACCCTTC
GCGCCATCCGGAGCTGCTCTATCGCGAACTGGCCAGGCTGGCCGGCAGTCTGCTGACTTTCTCCCTTGAA
CATCATCTGGAAGCAATCCCCCGCTACCGACATGCCTCGCCAGAGCAGGTATTCCCACCGCTTTTTGCCC
TGCTGGATACGCTGCTCGAAGTCAGCCTGCCCTCAAGGGTGATCGCCATCGCTCTGGAGCAGGGCGCCGA
CCGGGAGATCTGGCGGGGCAGGCTGCACGATGCGCGGCTGCGCGAGGGGGCGGATTTTTATCTGTCGGTG
CGCTCTTCACTCCCCCCTCACCAGCTACAGAGCCGCTTTCCGCAGCTCTGTAAGGCGGGTAGCCATGATG
ATGTCGCCGAGGTCGTCAATATTGCCCTCAGCGGCATCGCGATCAAACCGCTGAGCCATGTGCCGGCGGC
CATTCCGCTACGTCTGGAAAACCAATATTTCGCTCTGGATCTCTCCACCGATGCCGCCCGCGCGATGCTG
GAGGCTGGCAACTGCACCTTCTATACCCCGGAATCGCTTGGCGACGTGAAACTTGAACTCTTTGCGGTAC
TGCGCTCATGA
 Primer design