SecReT6
Protein ID: 530320894
SecReT6 ID839
T6SS typei3
Gene symbol-
Locus tagJCM7686_pAMI6p142
StrainParacoccus aminophilus JCM 7686
Repliconplasmid pAMI6 [GenBank: NC_022044] [Browse all T6SS(s) in this replicon]
Location [Strand]161600..165238 [-]
Producttype VI secretion system protein ImpL
NoteTssM
UniProt IDS5Y1Y6
KEGG IDpami:JCM7686_pAMI6p142
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 7.80E-86, Aligned region: 185..441
IcmF-related [PF06761], Evalue: 1.20E-66, Aligned region: 498..809
DUF1215 [PF06744], Evalue: 1.90E-25, Aligned region: 952..1074
AAA_16 [PF13191], Evalue: 0.003, Aligned region: 123..191
AAA_16 [PF13191], Evalue: 0.003, Aligned region: 603..651
AAA_16 [PF13191], Evalue: 0.003, Aligned region: 892..989
AAA_16 [PF13191], Evalue: 0.003, Aligned region: 1127..1150
DUF4381 [PF14316], Evalue: 0.0033, Aligned region: 41..97
DUF4381 [PF14316], Evalue: 0.0033, Aligned region: 449..487
AAA_19 [PF13245], Evalue: 0.0054, Aligned region: 124..140
AAA_19 [PF13245], Evalue: 0.0054, Aligned region: 1127..1136
AAA_25 [PF13481], Evalue: 0.0059, Aligned region: 124..140
AAA_25 [PF13481], Evalue: 0.0059, Aligned region: 171..204
AAA_25 [PF13481], Evalue: 0.0059, Aligned region: 400..424
AAA_25 [PF13481], Evalue: 0.0059, Aligned region: 737..781
AAA_25 [PF13481], Evalue: 0.0059, Aligned region: 1123..1135
Protein Sequence: 1212 a.a.     [Download]
>gi|530320894|ref|YP_008406854.1| type VI secretion system protein ImpL [Paracoccus aminophilus JCM 7686]
MRFFGIYVPRLRLRDHAWLRWTLLIFGLAAFGIAVWIGGPMTGWAPLASVFWRVIIIGVVYLFFFTIFFI
RWRRRVRAARALEEALIPAEPEGDGKVLAEKMTEAMAVLRKTGGASYLYDLPWYVIIGPPGAGKTTALAN
SGIEFPLAQNQGVSGFGGTRYIDFWFSEEAVMIDTAGRYTSQDSDAVADKASWTALLEQLKRTRPNRPIN
GVILSFSVEDLMKDDATALKSHAETVRARLAEIHEALKIDFPVYVMFTKADLIAGFREYFASFSLNRRKL
VWGTTFQNKDRKAITVEAVPAEFDRLVARLSDEIIDRMSEEPDGISRISIFGLPGQMALLRGHLTEFMKR
IFEPTRYKTNAILRGFYFTSGTQEGTPIDQVLGAMNRGDEYGGFQPSFMSGRGKSFFIHDLLTRVIFPEQ
GWVSHDRKAVRRAMILRGTAIGLILFASVGTAGALGYSYWKNRSLVNTAEAETAAYHRAAQKELSREVID
DTDLRPIAPLLGRLAAMPAGYGDSEEPGFFEGLGLGQRERLNRAATATYSDALERMLRPRMVLDLERRMP
GIVASGEMTDIYRALKVYLLLGGQGQSPDDTAVESWFDQIWREEYPERADVDMRDQLKRHLIAMLKLGKD
RKLLVTLDQTTVEAARAALSQLPLDEQAYALIQDGIAATSLQEWSLTQVVANSGQVFKTRDGQDLASLTV
PALYTYEGFWGYFFDQLAVVQDQLRKDQWVLGDLGNSDEIEIRLRRLDRDLMERYKNDFIASWNKVLNNL
ELASMVADKPRYAALGTAASASASPILELVKAVDDQTYLSREFDGMDDLSADQLAGLTAAPGQGGSVEGG
AKDVGKALASRFQSRSSGIQRMILDATARQAKKGQTRAGGAAPEENYSFRRPIDQISEAFKGWHDLVQGD
PGKRPIDTLIGNFGAIWENLRLAEHSPDQSAAALPTLLNALTQYNSQLPAPLAQIVNDADGYFRSGASDA
SLETMNRALTNQITFFCRDNITSSYPFSKSTRSLSMDNFARFFGPGGEMDKYFTQYLEPYVERSDGGLSY
RADKEITGRFNAATLKQFERAERIRRAFFAGGGSQPQVEITVAQVDAHPTVQEALLSINDEKIQTVTGSL
PQTVTWPGKGKSTLLQIMPSLDRPSALLFEGSSWTFMELLAAASSKQQMGDTLRATFTIGGRNITYDFTV
NAVANPFTMPEIRDFQCPQSID
 
Nucleotide Sequence: 3639 bp     [Download]
>gi|530320752|ref|NC_022044.1|:c165238-161600 Paracoccus aminophilus JCM 7686 plasmid pAMI6, complete sequence
GTGAGATTTTTCGGTATTTATGTCCCCCGGCTGCGGCTGCGCGATCACGCCTGGCTGCGCTGGACCCTGC
TGATCTTCGGGCTGGCGGCCTTCGGGATTGCCGTCTGGATCGGCGGGCCGATGACCGGATGGGCGCCGCT
GGCCTCGGTCTTCTGGCGCGTCATCATCATCGGCGTGGTTTATCTCTTCTTCTTCACCATCTTCTTCATC
CGCTGGCGCCGTCGCGTCCGCGCCGCCCGCGCGCTCGAAGAGGCGCTGATCCCGGCCGAGCCCGAGGGCG
ACGGCAAGGTGCTGGCCGAGAAGATGACCGAAGCCATGGCGGTTCTGCGCAAGACCGGCGGCGCGTCTTA
TCTGTATGACCTGCCGTGGTATGTGATCATCGGCCCGCCCGGCGCGGGCAAGACCACCGCGCTTGCGAAT
TCCGGCATCGAGTTCCCGCTGGCGCAAAATCAGGGCGTCTCTGGCTTTGGCGGCACGCGCTATATCGACT
TCTGGTTCTCGGAAGAGGCGGTGATGATCGACACCGCCGGGCGCTATACCTCGCAAGACAGCGATGCGGT
GGCCGACAAGGCGAGCTGGACCGCGCTGCTTGAGCAGTTGAAGCGGACCCGGCCCAACCGGCCGATCAAT
GGCGTGATCCTGTCCTTCTCGGTCGAGGATCTGATGAAGGACGACGCCACCGCGCTCAAATCCCATGCCG
AGACCGTGCGCGCCCGTCTGGCCGAGATCCACGAGGCGCTCAAGATCGATTTCCCGGTCTATGTCATGTT
CACCAAGGCCGATCTGATTGCGGGCTTCCGGGAATATTTCGCCTCGTTCAGCCTCAACCGGCGCAAGCTC
GTCTGGGGCACGACCTTCCAGAACAAGGACCGCAAGGCGATCACGGTCGAGGCTGTGCCCGCCGAATTCG
ACCGCCTTGTCGCGCGGCTCTCGGATGAGATCATCGACCGCATGTCGGAAGAGCCCGACGGGATCTCGCG
GATCTCGATCTTTGGTCTGCCGGGCCAGATGGCGCTGCTGCGCGGTCATCTGACCGAATTCATGAAGCGC
ATCTTCGAGCCGACGCGCTACAAGACCAATGCGATCCTGCGGGGCTTTTACTTCACCTCGGGCACGCAGG
AAGGCACGCCGATCGATCAGGTTCTCGGCGCGATGAACCGGGGCGACGAATATGGCGGCTTCCAGCCCTC
GTTCATGTCGGGGCGCGGGAAAAGCTTCTTCATCCACGACCTACTGACCCGGGTGATCTTTCCCGAACAG
GGCTGGGTCTCGCATGACCGCAAGGCGGTGCGCCGGGCGATGATCCTGCGCGGCACGGCGATCGGGCTGA
TCCTGTTCGCATCCGTGGGGACGGCGGGTGCGCTCGGGTATAGCTATTGGAAGAACCGCAGCCTCGTGAA
CACCGCCGAGGCCGAAACCGCCGCCTATCACCGCGCCGCGCAAAAAGAGCTCTCGCGCGAGGTCATCGAC
GACACCGATCTGCGCCCGATCGCACCGCTGCTTGGACGGCTCGCGGCGATGCCTGCGGGTTACGGCGACA
GCGAAGAGCCGGGCTTTTTCGAGGGGCTCGGCCTTGGCCAGCGCGAGCGGCTGAACCGCGCCGCCACCGC
GACCTATTCGGATGCGCTCGAGCGGATGTTGCGCCCGCGCATGGTGCTGGATCTCGAGCGGCGGATGCCC
GGCATCGTCGCCAGCGGCGAGATGACCGACATTTACCGCGCGCTCAAGGTCTATCTGCTGCTGGGCGGGC
AGGGCCAGAGCCCCGATGACACCGCCGTCGAAAGCTGGTTCGACCAGATCTGGCGCGAGGAATATCCCGA
ACGCGCCGATGTCGACATGCGCGACCAGCTCAAGCGCCATTTGATCGCGATGCTGAAGCTTGGCAAGGAC
CGCAAGCTTCTGGTGACACTTGACCAGACCACGGTCGAGGCCGCCCGCGCCGCGCTGTCGCAACTGCCGC
TGGACGAGCAGGCCTATGCGCTGATCCAAGACGGGATCGCCGCGACCAGTCTGCAGGAATGGAGCCTGAC
GCAAGTCGTCGCCAATTCCGGGCAGGTCTTCAAGACCCGCGACGGACAGGACCTCGCGAGCCTCACCGTG
CCCGCGCTTTATACCTATGAGGGCTTCTGGGGCTATTTCTTCGACCAGCTCGCCGTCGTGCAGGATCAGC
TGCGCAAAGACCAATGGGTGCTGGGCGATCTCGGCAACAGCGACGAGATCGAGATCCGTCTGCGCCGGCT
CGATCGCGATTTGATGGAGCGTTACAAAAACGACTTCATCGCAAGCTGGAACAAGGTTCTGAACAATCTT
GAGCTGGCTTCGATGGTCGCGGACAAGCCGCGTTATGCGGCGCTTGGCACGGCGGCCTCGGCCTCGGCCT
CGCCGATCCTCGAACTGGTCAAGGCGGTGGACGACCAGACCTATCTCTCGCGCGAATTCGACGGGATGGA
TGATCTCTCGGCCGATCAACTGGCCGGGCTGACCGCCGCGCCGGGGCAGGGCGGTTCGGTCGAGGGCGGC
GCGAAGGATGTCGGCAAGGCCTTGGCCAGCCGCTTCCAAAGCCGCTCGAGCGGGATCCAACGCATGATTC
TGGACGCGACCGCGCGGCAGGCCAAGAAGGGCCAGACCCGCGCAGGCGGCGCCGCGCCCGAAGAGAATTA
CAGCTTCCGCCGCCCGATCGACCAGATCTCCGAGGCCTTCAAGGGCTGGCACGATCTGGTTCAGGGTGAT
CCCGGCAAGCGTCCGATCGACACGCTGATCGGCAATTTCGGCGCGATCTGGGAAAACCTGCGTCTGGCCG
AGCACAGCCCCGACCAATCAGCGGCCGCCTTGCCGACGCTGCTGAATGCGCTGACGCAGTATAATTCGCA
GCTGCCCGCGCCTTTGGCCCAGATCGTGAATGATGCGGATGGCTATTTCCGTTCGGGCGCGAGCGATGCG
AGCCTCGAGACGATGAACCGTGCGCTGACCAATCAGATCACCTTCTTCTGTCGCGACAATATCACCTCGT
CCTACCCGTTCTCGAAATCGACGCGCTCGCTCTCGATGGACAATTTCGCGCGGTTCTTCGGGCCGGGCGG
CGAGATGGACAAATATTTCACCCAATATCTCGAACCCTATGTCGAGCGCAGCGATGGCGGGCTCAGCTAT
CGCGCCGACAAGGAAATCACCGGGCGCTTCAATGCCGCAACGCTCAAGCAGTTCGAGCGCGCCGAGCGCA
TCCGCCGCGCCTTCTTCGCGGGCGGGGGCAGCCAGCCGCAGGTCGAGATCACGGTGGCGCAGGTCGATGC
TCATCCGACCGTGCAAGAGGCGCTTTTGTCGATCAATGACGAAAAGATCCAGACCGTGACCGGCTCTTTG
CCCCAGACGGTGACTTGGCCGGGCAAGGGCAAATCGACGCTTCTGCAGATCATGCCCTCGCTCGACCGGC
CCTCGGCGCTGCTGTTCGAGGGCAGTTCCTGGACCTTCATGGAGCTTTTGGCGGCGGCGAGCTCCAAGCA
GCAGATGGGCGACACGTTGCGCGCGACCTTCACCATCGGCGGGCGCAACATCACCTATGATTTCACCGTG
AACGCGGTCGCCAATCCTTTCACCATGCCCGAAATCAGGGATTTCCAATGTCCCCAGAGCATCGATTGA
 Primer design