SecReT6
Protein ID: 530630592
SecReT6 ID841
T6SS typei2
Gene symbol-
Locus tagN559_2915
StrainKlebsiella pneumoniae JM45
Repliconchromosome [GenBank: NC_022082] [Browse all T6SS(s) in this replicon]
Location [Strand]2967042..2970467 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDS5YPT9
KEGG IDkpj:N559_2915
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.60E-70, Aligned region: 416..734
DUF1215 [PF06744], Evalue: 1.00E-33, Aligned region: 251..298
DUF1215 [PF06744], Evalue: 1.00E-33, Aligned region: 857..977
Protein Sequence: 1141 a.a.     [Download]
>gi|530630592|ref|YP_008425860.1| ImcF domain-containing protein [Klebsiella pneumoniae JM45]
MDNVNKPAAISVAATVIVCIAAVTLLVLLGGLAWWLWAMDRATQWETLRPLIATGFIIWGMALSLLVLGF
MAFRLLIKDKVKPSAAPVRQPTRPAGGEALYAPLKKHLHARYRLHWRRKVRLLLVTGDEAAIEQLVPGLR
QQRWLEGQRTVLIYGGSLLSEPDSEQYAALRKLRHGRPLDGIVRVMPSSLTLTPQISESDLRGLEKISEL
LGYAAPVWLWKLCDSEWPQADRAEQAVGVSFPLRATEEDVARQLAQMLPTLREQGMHQIAADTRHDFLLR
LGQQLIDGEIAQWRRQLAPWLTASRQRLALRGLMFSLPEPRTVDPYQEADALPASQPHLLTLPATWQGIV
DDCRRLRGHHVGMAWERGLACGLLAIFGLWAAGLLLSFALNYSQIASVAGKARDLVAHPSVSDYQLTALH
ALRNEAGRLVHDGQNGAPWYRRFGLDHHQQLLDAVLPWYGVANHRLIRDPANAALQQALSALVNSAPNSD
QRAQLAKPGYDQLKAWLMMARPDKADGAFFAQTMKTVQPTRMGISTGLWQSLAPDLWAFYLSLLPERPEW
KIIPDAQRVSQSRQVLLQQLGRRNAESTLYENMLKSVRRNFADVSLEDMTSGTDARRLFTTNEVVPGMFT
RQAWEGGIQQAIDKAASSRREEIDWVLSDSRKTMSTDLSPEALKARLTRRYFTDFAGSWLNFLNSLRLNP
ATTIADVTDQLTLISGVRQSPLIALMNTLAWQGQAGQQREGLSDSLIKSAKDLVGGKDKPVIDQSAAGPQ
GPLDDTFGPLLQLMGKNTGSNVMSADSTLSLQTYLTRITRVRLRLQQVANASDPQEMMQTLAQTVFLGKS
VDLTDTQQYGSLISASLGEEWSGFGNTLFVQPLTQAWETVLLPSAASLNDKWRRSVVANWHTAFDGRFPF
AASKSDASLPMLAEFVRKDSGRIERFLTTELNGVLHKEGSQWVPDKVNSHGLVFNPAFLRAINQLSQLSD
ILFTDGSQGISFELQARPAPEVVETQLTIDGQKLRYFNQMADWQTFRWPGETYKPGTLLTWTTVNAGTRL
FGDYSGTWGFIRWLEQGKRHPLDRSQWMMSFSAPDGRTLQWVLRSQLGSGPLALLALRGLTLPDQIFTVD
AAESAQALTTGVGNSDMDEME
 
Nucleotide Sequence: 3426 bp     [Download]
>gi|530627845|ref|NC_022082.1|:c2970467-2967042 Klebsiella pneumoniae JM45, complete genome
ATGGACAACGTCAATAAACCTGCCGCTATCTCTGTGGCGGCTACGGTTATCGTCTGTATTGCTGCGGTCA
CGCTTCTGGTGCTCCTGGGCGGGCTGGCATGGTGGCTATGGGCGATGGATCGTGCCACGCAGTGGGAAAC
GCTGCGCCCGCTTATCGCCACGGGCTTTATTATCTGGGGGATGGCACTCAGCCTGCTGGTACTGGGGTTT
ATGGCCTTTCGACTGCTGATAAAAGATAAGGTTAAGCCTTCAGCAGCGCCTGTGCGGCAACCCACCAGGC
CTGCCGGGGGCGAAGCCCTTTATGCCCCGCTGAAAAAGCACCTTCACGCACGTTACCGCCTGCACTGGCG
GCGCAAAGTCCGCCTGCTTTTAGTCACCGGCGACGAGGCGGCAATCGAACAACTGGTGCCTGGCCTGCGT
CAGCAGCGCTGGCTGGAGGGCCAGCGTACCGTTCTGATTTACGGCGGCAGTCTGCTCTCCGAGCCCGACA
GTGAGCAATATGCCGCGCTGCGCAAGCTGCGCCACGGTCGTCCTCTGGATGGGATTGTGCGGGTGATGCC
GTCGTCTCTCACCCTGACGCCGCAGATAAGCGAGAGCGACCTGCGCGGGCTGGAAAAAATCAGCGAACTG
CTGGGCTATGCCGCCCCGGTCTGGTTATGGAAACTGTGCGACAGTGAGTGGCCGCAGGCTGACCGCGCGG
AGCAGGCGGTAGGGGTTAGCTTCCCGTTGCGCGCCACTGAGGAAGATGTCGCCCGTCAGCTTGCGCAGAT
GTTGCCGACGCTACGGGAGCAGGGGATGCACCAGATCGCAGCAGATACCCGCCACGACTTCCTGCTGCGT
CTGGGGCAGCAGCTTATCGACGGGGAGATCGCACAATGGCGCCGGCAGCTGGCGCCGTGGCTGACCGCCT
CGCGGCAGCGGCTTGCGCTGCGAGGCCTGATGTTTAGCCTGCCAGAGCCTCGTACCGTAGATCCGTATCA
GGAAGCTGATGCCCTGCCTGCGAGCCAGCCTCACCTCCTGACGCTTCCCGCCACCTGGCAGGGGATCGTC
GATGACTGCCGCCGTTTACGCGGGCATCACGTGGGAATGGCATGGGAGCGGGGCCTGGCGTGCGGTCTGC
TGGCCATCTTCGGCCTGTGGGCGGCGGGACTGCTGCTCTCCTTTGCCCTCAATTACAGTCAGATTGCTTC
GGTAGCGGGAAAAGCCCGCGACCTGGTGGCCCACCCCTCCGTTTCTGACTATCAACTGACGGCCCTCCAT
GCCCTGCGCAATGAGGCCGGCCGTCTCGTGCACGATGGGCAGAATGGCGCTCCCTGGTATCGGCGCTTTG
GTCTGGACCATCATCAGCAACTATTAGACGCCGTCCTGCCCTGGTACGGTGTGGCGAATCATCGCCTGAT
ACGTGACCCGGCCAATGCCGCGTTGCAGCAGGCGCTCAGCGCGCTGGTCAACTCCGCCCCCAATAGCGAC
CAACGAGCCCAGCTGGCGAAACCGGGCTATGACCAGCTGAAAGCCTGGCTGATGATGGCTCGTCCGGATA
AAGCCGATGGCGCATTTTTTGCGCAGACCATGAAAACGGTCCAGCCGACGCGAATGGGGATCTCGACCGG
TCTGTGGCAAAGTCTGGCGCCGGATTTGTGGGCCTTTTATCTCTCCCTGCTGCCCGAGCGGCCAGAGTGG
AAGATCATCCCGGATGCGCAACGGGTGAGTCAGAGCCGTCAGGTTCTGTTGCAGCAGCTAGGTCGCCGCA
ATGCCGAAAGCACCTTATATGAGAACATGCTCAAATCCGTGCGTCGTAATTTTGCCGATGTATCGCTGGA
AGACATGACCAGTGGCACCGACGCGCGCCGGCTGTTTACCACCAATGAAGTGGTCCCGGGGATGTTTACC
CGCCAGGCATGGGAAGGCGGCATTCAGCAGGCCATTGATAAGGCAGCCAGCTCGCGCCGGGAGGAAATCG
ACTGGGTGCTGAGCGATTCGCGCAAAACGATGTCGACAGACCTGTCGCCGGAGGCGCTGAAAGCGCGTCT
GACCCGACGCTACTTCACCGATTTCGCCGGCAGCTGGCTGAATTTTCTCAACAGTCTGCGACTCAACCCA
GCGACCACCATTGCCGATGTTACCGACCAGCTCACGCTGATAAGCGGTGTCCGCCAGTCGCCGCTGATTG
CCCTGATGAATACCCTTGCCTGGCAGGGGCAGGCGGGGCAACAAAGGGAGGGGCTGTCGGACAGCCTTAT
TAAATCGGCCAAAGATCTGGTGGGCGGGAAAGACAAGCCGGTCATCGACCAGTCGGCAGCCGGCCCGCAG
GGGCCTCTGGATGACACGTTCGGACCACTGCTCCAGCTGATGGGGAAAAACACGGGCAGCAACGTCATGT
CGGCCGATAGCACCCTGAGCCTGCAAACCTATCTGACCCGTATCACCCGCGTGCGCCTGCGCCTGCAGCA
GGTTGCGAATGCCTCCGATCCGCAGGAGATGATGCAGACCCTGGCGCAGACCGTCTTCCTGGGGAAAAGC
GTCGACCTGACCGACACGCAACAGTACGGTAGCCTGATTTCGGCAAGCCTTGGCGAAGAGTGGAGTGGCT
TCGGTAATACTCTGTTTGTGCAGCCGCTGACTCAGGCCTGGGAAACCGTGCTTCTGCCGTCGGCGGCCAG
TCTGAATGATAAATGGCGCCGTTCGGTGGTCGCCAACTGGCACACCGCCTTTGACGGACGCTTTCCGTTT
GCCGCCAGCAAAAGCGATGCCTCCCTGCCGATGCTGGCTGAGTTTGTGCGCAAAGACAGCGGGCGAATCG
AACGTTTTCTCACGACGGAGCTGAACGGTGTCCTGCATAAAGAAGGCAGTCAATGGGTGCCGGATAAGGT
CAACAGTCACGGCCTGGTCTTTAATCCGGCCTTTCTGCGCGCGATCAACCAGCTAAGCCAGCTGTCCGAC
ATTCTTTTCACCGACGGCAGCCAGGGGATCAGCTTTGAGTTACAGGCCAGGCCTGCCCCGGAGGTTGTCG
AGACACAGCTGACGATAGACGGCCAAAAGTTGCGTTATTTCAATCAGATGGCCGACTGGCAGACTTTCCG
CTGGCCGGGGGAGACGTATAAACCCGGCACTCTGCTGACCTGGACCACCGTCAATGCGGGCACGCGTCTG
TTCGGTGACTACAGCGGTACCTGGGGCTTTATTCGCTGGCTGGAGCAGGGTAAACGCCATCCGCTGGATC
GCAGCCAGTGGATGATGAGCTTCTCCGCCCCGGATGGCCGCACCCTGCAGTGGGTATTGCGCTCCCAGCT
TGGGAGCGGCCCGCTGGCGCTTCTGGCGCTCCGCGGATTGACCCTGCCGGATCAGATTTTCACTGTCGAT
GCGGCTGAGAGCGCACAGGCCCTGACGACGGGGGTAGGGAATAGTGACATGGATGAGATGGAATAA
 Primer design