SecReT6
Protein ID: 53716505
SecReT6 ID69
T6SS typei3
Gene symbol-
Locus tagBMAA0454
StrainBurkholderia mallei ATCC 23344
Repliconchromosome II [GenBank: NC_006349] [Browse all T6SS(s) in this replicon]
Location [Strand]455875..459318 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ62DJ9
KEGG IDbma:BMAA0454
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.70E-69, Aligned region: 473..779
IcmF-related [PF06761], Evalue: 2.70E-69, Aligned region: 847..860
ImcF-related_N [PF14331], Evalue: 8.30E-29, Aligned region: 168..357
DUF1215 [PF06744], Evalue: 1.40E-27, Aligned region: 60..79
DUF1215 [PF06744], Evalue: 1.40E-27, Aligned region: 280..298
DUF1215 [PF06744], Evalue: 1.40E-27, Aligned region: 884..1009
Protein Sequence: 1147 a.a.     [Download]
>gi|53716505|ref|YP_105229.1| unnamed protein product [Burkholderia mallei ATCC 23344]
MGPLFAFGIYHPLGPVWVREILVALVLIWGFWPTLARLWARLAMSPRQVKVAPKAKQLDFVDKHLRTLDQ
QLKERWRKEPRGRWKRWVGALTREHRTMLPWYLVLGSEGSGKSSLVAKAVSVSGSLQDRVLGSDATYGRG
DDLNFRITREAVWFDVGGRWSLRAGADEAEFDAWRKLLRGMRRLRRGAPISGVVLCVDGLEMIDAPLDAR
KRLADSVRARLEEMREAFGQQVQVYVALNGLDRLDGAVSTLSLLEASKWVKGVGFSLPDDGAHADAARAD
ASWQHALQGLQQRVQQQVLYSAPAATEVSMNHAQLRFVETLSRLQKGLVAWLHVALAPGEPHTAARLRGV
WLGSMAELAEPHPAGAGGVGSAELPVPSRPLSELWTPLIRQVALERDAVRPSGPKSWRGRLGEALRWGAV
PLVALSLLLWFGWGYVTERDYLDGVWAQFTEAKRLAQAEASYGNDGGSTLIEIANQMRYAQLQAEDAAQG
MATPYFEHGLVAETARETYYRHLQKMLMPELYNEVRRTLVSQVDGSPGDIYQTLKVYLMLCRPARRSADD
VVRWLDGRWDALSGGQYSDDDRRSLLAHVRTLMSLKEVPATPEDANLVRSARAKAAQIPLVTRVLQHIHA
QGLPQQVNDISLSRAAGFEASMSLRMRSNVPSTDTAVSGWFTRAGYTDVFLPRLQKSARAMLEEESWVLR
DETLSGNSFQIDGLVQKLADSARNQFLQDYISAWQNFLNDVTVRGVTGLDDASQLAAAMMEAQSPLANLL
RFAARETTLTGASDEGNIDSWIDRQKYRFEKGRRQVVGELSGQHYRTVLLPEHVVEEHFQAIRQLAAQLN
RNNTIANNPLSRLFEPLYRQLGLVNGALQAGQVLPAQYDAFSRLKETAARQPEPVRGIMLDLVSSGSTMT
TRESGALLNRGAAGATKMVCDQGFTGRYPMRRGAQADAGVEDFERLFSAQGLMATYFRDHLAAYVDTSAK
PWQALRSNGGPNGMVSQSVLNSYETAERIRGAMLDDSGHLRVSTVLRFIDMDSQLSEAQLSVAGQTVRFA
HGVTSPHRVDWTNQNTQLAIKLQLKSVDGRMTTLQFDGPWALFRFFDAGQAVGGTGTADRRERLYQTSLG
TVRIEWQALTLPSPIWSGILQSFRCPS
 
Nucleotide Sequence: 3444 bp     [Download]
>gi|77358719|ref|NC_006349.2|:455875-459318 Burkholderia mallei ATCC 23344 chromosome 2, complete sequence
GTGGGGCCGCTGTTCGCGTTCGGCATCTATCACCCGCTCGGCCCGGTGTGGGTGCGCGAGATCCTCGTCG
CACTGGTGCTGATCTGGGGCTTCTGGCCGACGCTCGCGCGGCTCTGGGCGCGGCTCGCGATGAGCCCGCG
GCAGGTGAAGGTCGCGCCGAAGGCCAAGCAGCTCGATTTCGTCGACAAGCATCTGCGCACCCTCGACCAG
CAGTTGAAGGAGCGCTGGCGCAAGGAGCCGCGCGGCCGCTGGAAGCGCTGGGTCGGCGCGCTCACGCGCG
AGCATCGCACGATGCTGCCGTGGTATCTGGTGCTCGGCTCCGAGGGTAGCGGCAAGTCGAGCCTCGTCGC
GAAGGCGGTGAGCGTGTCCGGCTCGCTGCAGGACCGGGTGCTCGGCTCGGACGCGACCTACGGGCGCGGC
GACGACTTGAACTTCCGCATCACGCGCGAGGCGGTGTGGTTCGACGTCGGCGGCCGCTGGAGCCTGCGCG
CGGGTGCCGACGAGGCCGAGTTCGACGCGTGGCGCAAGCTGCTGCGCGGGATGAGGCGGCTGCGCAGGGG
CGCGCCGATCAGCGGCGTCGTGCTGTGCGTCGACGGCCTCGAGATGATCGATGCGCCGCTCGACGCGCGC
AAGCGGCTGGCCGATTCGGTGCGCGCGCGGCTCGAGGAGATGCGCGAGGCGTTCGGCCAGCAGGTGCAGG
TGTACGTTGCGCTGAACGGGCTCGACCGGCTCGACGGCGCGGTCTCGACGCTGTCGCTGCTCGAGGCGTC
GAAGTGGGTCAAGGGCGTGGGCTTCAGCCTGCCCGACGACGGCGCGCACGCCGACGCCGCGCGCGCGGAC
GCGAGCTGGCAGCACGCGCTGCAAGGGCTGCAGCAGCGGGTCCAGCAGCAGGTGCTGTATTCGGCGCCGG
CGGCGACCGAGGTGTCGATGAACCACGCGCAGTTGCGCTTCGTCGAGACGCTCAGCCGCCTGCAGAAGGG
GCTCGTCGCGTGGCTGCACGTCGCGCTCGCGCCGGGCGAGCCGCACACGGCCGCGCGGCTGCGCGGGGTG
TGGCTGGGCTCGATGGCCGAGCTCGCGGAGCCGCATCCGGCGGGCGCGGGCGGCGTCGGCTCGGCGGAGC
TGCCCGTGCCGTCGCGCCCGCTCAGCGAGCTGTGGACGCCGCTCATCCGGCAGGTGGCGCTCGAGCGCGA
CGCGGTGCGCCCGAGCGGGCCGAAGTCGTGGCGCGGGCGCCTGGGCGAGGCGCTGCGCTGGGGCGCGGTG
CCCCTCGTCGCGTTGAGCCTGCTGCTGTGGTTCGGCTGGGGCTACGTCACCGAGCGCGACTATCTGGACG
GCGTCTGGGCGCAGTTCACCGAGGCCAAGCGGCTCGCGCAGGCCGAGGCGTCCTACGGCAACGACGGCGG
CTCGACGCTCATCGAGATCGCGAACCAGATGCGCTATGCGCAACTGCAGGCCGAGGACGCCGCGCAGGGC
ATGGCGACGCCGTACTTCGAGCACGGGCTCGTCGCGGAGACCGCGCGCGAGACCTACTACCGGCACTTGC
AGAAGATGCTGATGCCGGAGTTGTACAACGAGGTGCGGCGCACGCTCGTGTCGCAGGTCGACGGCAGCCC
GGGCGACATCTACCAGACGCTGAAGGTCTACCTGATGCTCTGCCGCCCCGCGCGGCGCTCGGCGGACGAC
GTCGTGCGCTGGCTCGACGGCCGCTGGGACGCGCTCTCGGGCGGGCAGTACTCGGACGACGACCGCCGCT
CGCTGCTCGCGCACGTGCGCACGCTGATGTCGCTGAAGGAGGTGCCGGCCACGCCGGAGGACGCGAACCT
CGTGCGCTCGGCGCGCGCGAAGGCCGCGCAGATCCCGCTCGTCACGCGCGTGCTGCAGCACATCCACGCG
CAGGGGCTGCCGCAGCAGGTCAACGACATCTCGCTGTCGCGCGCGGCGGGCTTCGAGGCGTCGATGAGCC
TGCGCATGCGCAGCAACGTGCCGTCGACCGACACCGCGGTGTCGGGCTGGTTCACGCGCGCGGGCTACAC
GGACGTGTTCCTGCCGCGCCTGCAGAAGAGCGCGCGCGCGATGCTCGAGGAGGAGAGCTGGGTGCTGCGC
GACGAGACGCTGTCGGGCAACAGCTTCCAGATCGACGGACTCGTGCAGAAGCTCGCCGATTCGGCGCGCA
ACCAGTTCCTGCAGGACTACATCTCCGCGTGGCAGAACTTCCTGAACGACGTGACGGTGCGCGGCGTGAC
GGGCCTGGACGATGCGTCGCAGCTCGCCGCGGCGATGATGGAGGCGCAATCGCCGCTCGCGAACCTGCTG
CGCTTCGCCGCGCGCGAGACGACGCTCACGGGCGCGAGCGACGAAGGCAACATCGACAGCTGGATCGATC
GCCAGAAGTACCGCTTCGAGAAGGGGCGGCGGCAGGTCGTCGGCGAGCTGAGCGGGCAGCATTACCGCAC
GGTGCTGCTGCCGGAGCACGTGGTCGAGGAGCACTTCCAGGCGATCCGCCAGCTCGCCGCGCAACTGAAC
CGCAACAACACGATCGCGAACAACCCGCTGTCGCGGCTGTTCGAGCCGCTGTACCGGCAGCTCGGGCTCG
TCAACGGCGCGCTGCAGGCGGGCCAGGTGCTGCCCGCGCAGTACGACGCGTTCTCGCGGCTGAAGGAGAC
GGCCGCGCGCCAGCCGGAGCCGGTGCGCGGGATCATGCTCGACCTCGTGAGCAGCGGCAGCACGATGACG
ACGCGCGAATCGGGCGCGCTGCTCAACCGGGGCGCGGCGGGCGCGACGAAGATGGTCTGCGATCAGGGCT
TCACGGGCCGCTATCCGATGCGCCGCGGCGCGCAGGCGGATGCGGGCGTGGAGGACTTCGAGCGGCTGTT
CAGCGCGCAGGGGCTGATGGCGACGTACTTCCGCGATCACCTCGCCGCGTATGTGGACACGTCGGCCAAG
CCGTGGCAGGCGCTGCGCTCGAACGGCGGGCCGAACGGGATGGTGAGCCAGTCGGTGCTGAACTCGTACG
AGACGGCCGAGCGCATCCGCGGCGCGATGCTCGACGATTCGGGGCACCTGCGCGTGTCGACCGTGCTGCG
TTTCATCGACATGGATTCGCAGTTGTCCGAAGCGCAGCTGAGCGTGGCTGGGCAGACGGTGCGCTTCGCG
CACGGCGTGACCTCGCCGCACCGGGTGGACTGGACCAACCAGAACACGCAGCTCGCGATCAAGCTGCAGC
TCAAATCGGTGGACGGCCGGATGACGACGCTGCAGTTCGACGGGCCGTGGGCGCTGTTCCGCTTCTTCGA
CGCGGGGCAGGCGGTGGGCGGCACGGGCACCGCGGACCGGCGCGAGCGGCTGTATCAGACGAGCCTCGGC
ACGGTGCGCATCGAATGGCAGGCGCTCACGCTGCCGTCGCCGATATGGTCGGGCATCCTGCAGTCGTTCA
GGTGTCCGTCGTGA
 Primer design