SecReT6
Protein ID: 53720708
SecReT6 ID77
T6SS typei4b
Gene symbol-
Locus tagBPSL3099
StrainBurkholderia pseudomallei K96243
Repliconchromosome I [GenBank: NC_006350] [Browse all T6SS(s) in this replicon]
Location [Strand]3702074..3703006 [+]
Productouter membrane protein
NoteTagL
UniProt IDQ63QC4, Q63QC4
KEGG IDbps:BPSL3099
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 1.40E-25, Aligned region: 144..177
OmpA [PF00691], Evalue: 1.40E-25, Aligned region: 208..302
Protein Sequence: 310 a.a.     [Download]
>gi|53720708|ref|YP_109694.1| outer membrane protein [Burkholderia pseudomallei K96243]
MTKPRLPLLRARRFALAFAALALGGAARADNVGPATVTAIDAGGVPVKSVPLAAPVTAAPVAATAGAGAT
VSSPPPANATPGQVVAGGKVADEATKAAVLQRLRDTYGAANVVDQIEIGNVATPPNWSANVQKLIGPQLK
QISKGQLKIDGTQIDVKGEVHNEAQRQQLASDMANALNPTYTIKNGLRVSASEQGLLDQTLANRTIEFET
GSATLTPQGRAILDQMAGALAKMSNRTVEIIGHTDNSGNRTSNIALSQARADAVKGYLVTKGIASQQLTT
TGVGPDQPIAPNDSADGRARNRRIEFRAGQ
 
Nucleotide Sequence: 933 bp     [Download]
>gi|53717639|ref|NC_006350.1|:3702074-3703006 Burkholderia pseudomallei K96243 chromosome 1, complete sequence
ATGACGAAGCCCCGCCTGCCCCTGCTGCGCGCCCGCCGCTTCGCGCTCGCGTTCGCCGCGCTCGCGCTCG
GCGGCGCCGCGCGCGCCGACAACGTCGGCCCCGCCACCGTCACGGCGATTGACGCAGGCGGCGTGCCCGT
GAAATCGGTGCCGCTCGCCGCGCCCGTGACGGCCGCGCCGGTCGCCGCGACGGCCGGCGCGGGCGCGACC
GTGTCGTCGCCGCCGCCCGCGAACGCGACGCCGGGCCAGGTCGTCGCCGGCGGCAAGGTTGCCGACGAAG
CGACGAAGGCCGCCGTGCTGCAGCGCCTGCGCGACACGTACGGCGCCGCGAACGTCGTCGACCAGATCGA
AATCGGCAACGTCGCGACGCCGCCGAACTGGTCCGCGAACGTCCAGAAGCTGATCGGCCCGCAACTGAAA
CAGATCAGCAAAGGACAGCTGAAGATCGACGGCACGCAGATCGACGTGAAGGGCGAAGTGCACAACGAGG
CGCAGCGCCAGCAGCTCGCGAGCGACATGGCGAACGCGCTGAATCCGACCTACACGATCAAGAACGGGCT
GCGCGTGAGCGCGTCCGAGCAGGGCCTGCTCGACCAGACGCTCGCGAACCGCACGATCGAATTCGAAACC
GGCAGCGCGACGCTCACGCCGCAAGGCCGCGCGATTCTCGACCAGATGGCGGGCGCGCTCGCGAAGATGT
CGAACCGAACGGTCGAGATCATCGGGCACACCGACAACTCGGGCAACCGCACGTCGAACATCGCGCTCAG
CCAGGCGCGCGCGGATGCGGTCAAGGGATATCTGGTGACGAAGGGCATCGCGTCGCAGCAACTGACGACG
ACGGGCGTCGGCCCCGATCAGCCGATCGCGCCGAACGATTCGGCCGACGGTCGCGCACGCAATCGCCGGA
TCGAATTCCGCGCGGGACAGTAA
 Primer design