SecReT6
Protein ID: 53720710
SecReT6 ID77
T6SS typei4b
Gene symbolclpB
Locus tagBPSL3101
StrainBurkholderia pseudomallei K96243
Repliconchromosome I [GenBank: NC_006350] [Browse all T6SS(s) in this replicon]
Location [Strand]3704416..3707085 [-]
Productprotease associated ATPase ClpB
NoteTssH
UniProt IDQ63QC2
KEGG IDbps:BPSL3101
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.00E-44, Aligned region: 231..328
AAA_2 [PF07724], Evalue: 3.00E-44, Aligned region: 619..787
AAA [PF00004], Evalue: 6.50E-19, Aligned region: 232..345
AAA [PF00004], Evalue: 6.50E-19, Aligned region: 624..719
ClpB_D2-small [PF10431], Evalue: 2.80E-13, Aligned region: 794..868
AAA_5 [PF07728], Evalue: 4.70E-13, Aligned region: 232..252
AAA_5 [PF07728], Evalue: 4.70E-13, Aligned region: 306..362
AAA_5 [PF07728], Evalue: 4.70E-13, Aligned region: 623..744
Clp_N [PF02861], Evalue: 4.30E-12, Aligned region: 27..74
Clp_N [PF02861], Evalue: 4.30E-12, Aligned region: 114..131
AAA_16 [PF13191], Evalue: 4.30E-10, Aligned region: 55..77
AAA_16 [PF13191], Evalue: 4.30E-10, Aligned region: 209..256
AAA_16 [PF13191], Evalue: 4.30E-10, Aligned region: 276..310
AAA_16 [PF13191], Evalue: 4.30E-10, Aligned region: 469..496
AAA_16 [PF13191], Evalue: 4.30E-10, Aligned region: 614..661
AAA_16 [PF13191], Evalue: 4.30E-10, Aligned region: 690..712
AAA_16 [PF13191], Evalue: 4.30E-10, Aligned region: 742..869
AAA_22 [PF13401], Evalue: 9.40E-07, Aligned region: 232..318
AAA_22 [PF13401], Evalue: 9.40E-07, Aligned region: 351..392
AAA_22 [PF13401], Evalue: 9.40E-07, Aligned region: 620..644
AAA_22 [PF13401], Evalue: 9.40E-07, Aligned region: 685..717
Sigma54_activat [PF00158], Evalue: 5.60E-06, Aligned region: 214..248
Sigma54_activat [PF00158], Evalue: 5.60E-06, Aligned region: 621..741
AAA_17 [PF13207], Evalue: 0.00014, Aligned region: 69..107
AAA_17 [PF13207], Evalue: 0.00014, Aligned region: 233..302
AAA_17 [PF13207], Evalue: 0.00014, Aligned region: 623..659
AAA_17 [PF13207], Evalue: 0.00014, Aligned region: 817..835
IstB_IS21 [PF01695], Evalue: 0.00017, Aligned region: 223..253
IstB_IS21 [PF01695], Evalue: 0.00017, Aligned region: 623..641
IstB_IS21 [PF01695], Evalue: 0.00017, Aligned region: 798..834
AAA_29 [PF13555], Evalue: 0.00021, Aligned region: 224..248
AAA_29 [PF13555], Evalue: 0.00021, Aligned region: 619..648
AAA_29 [PF13555], Evalue: 0.00021, Aligned region: 719..751
Zeta_toxin [PF06414], Evalue: 0.00028, Aligned region: 128..163
Zeta_toxin [PF06414], Evalue: 0.00028, Aligned region: 231..252
Zeta_toxin [PF06414], Evalue: 0.00028, Aligned region: 613..663
AAA_19 [PF13245], Evalue: 0.00036, Aligned region: 230..258
AAA_19 [PF13245], Evalue: 0.00036, Aligned region: 620..645
NACHT [PF05729], Evalue: 0.00081, Aligned region: 232..259
NACHT [PF05729], Evalue: 0.00081, Aligned region: 375..462
NACHT [PF05729], Evalue: 0.00081, Aligned region: 624..643
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 211..246
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 284..336
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 621..662
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 694..717
AAA_14 [PF13173], Evalue: 0.0013, Aligned region: 233..365
AAA_14 [PF13173], Evalue: 0.0013, Aligned region: 622..704
AAA_25 [PF13481], Evalue: 0.0036, Aligned region: 232..255
AAA_25 [PF13481], Evalue: 0.0036, Aligned region: 288..327
AAA_25 [PF13481], Evalue: 0.0036, Aligned region: 442..493
AAA_25 [PF13481], Evalue: 0.0036, Aligned region: 525..551
AAA_25 [PF13481], Evalue: 0.0036, Aligned region: 619..643
AAA_30 [PF13604], Evalue: 0.0047, Aligned region: 16..40
AAA_30 [PF13604], Evalue: 0.0047, Aligned region: 217..309
AAA_30 [PF13604], Evalue: 0.0047, Aligned region: 466..499
AAA_30 [PF13604], Evalue: 0.0047, Aligned region: 619..652
SRP54 [PF00448], Evalue: 0.006, Aligned region: 232..253
SRP54 [PF00448], Evalue: 0.006, Aligned region: 438..507
SRP54 [PF00448], Evalue: 0.006, Aligned region: 622..653
MobB [PF03205], Evalue: 0.0096, Aligned region: 233..256
MobB [PF03205], Evalue: 0.0096, Aligned region: 622..655
Protein Sequence: 889 a.a.     [Download]
>gi|53720710|ref|YP_109696.1| protease associated ATPase ClpB [Burkholderia pseudomallei K96243]
MSTPLKTLIAKLNPVCRKAAERAASHCFARGHYEVDLEHLFLALLDESTGDVPLVLRASGVDPHALRADL
ERELERLKTGNTRTPVFSVHLSELFEQAWLIASLDSQIGRIRSGHLLLALLTGPDLAQFAQRMSSQFARV
RVDDLKHKFDEIAAGSSEAEPRHADADVAVPDGAAASGDAPRGPSKTPALDTYTTNLTQRAREGKIDPVI
GRDAEIRQAIDILMRRRQNNPIMTGEAGVGKTAVVEGLALRIAADDVPPPLRGVALHVLDMGLLQAGASV
KGEFENRLKSVIDEVKKSAHPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYKK
YFEKDAALARRFQVVKIEEPSEPLAAAMLRGMAALMERHFNVRVLDDAITEAVRLSHRYISGRQLPDKAI
SVLDTACAKVALAHSSTPAAIDDAKKRIERIDAEIAALEREAASGAAHDARLAELREARDADLKALAEDA
ARYEEERALVTEIGALRAELDAARESSADGKPVDVDATRAKLAERVDALRARQGNQPMVPLQVDGHVVAE
IVASWTGIPLGRMVKDEIETVLNLRDLLGARVIGQDHALGAIAQRVRTATANLEDPNKPRGVFMFVGPSG
VGKTETALALADVLYGGERKLITINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRNPYSVVLLDE
VEKAHPDVLEMFFQVFDKGAMDDAEGREIDFRNTLIILTSNVGSSAVMQACLNKAPQELPDAETLAETLR
PQLYKTFKPAFLGRMKVIPYYPISDDVLAEIIELKLERIRRRIEANHKAAFEWDESLVDAVLARCTEVDS
GARNVDHILNGTLLPEIAELVLSRIADGEAIVRIAARAAETGEFEYTVE
 
Nucleotide Sequence: 2670 bp     [Download]
>gi|53717639|ref|NC_006350.1|:c3707085-3704416 Burkholderia pseudomallei K96243 chromosome 1, complete sequence
ATGAGCACGCCCCTGAAGACCCTGATCGCGAAACTGAACCCGGTGTGCCGCAAGGCCGCCGAGCGCGCCG
CCAGCCACTGCTTCGCGCGCGGTCACTACGAAGTGGATCTCGAGCATCTGTTTCTCGCGCTGCTCGACGA
GTCGACCGGTGACGTGCCGCTCGTGCTGCGCGCGAGCGGCGTCGATCCGCACGCGCTGCGCGCGGATCTC
GAGCGCGAGCTCGAAAGACTGAAAACGGGCAACACGCGCACGCCGGTGTTTTCGGTGCATCTGAGCGAGC
TGTTCGAGCAGGCGTGGCTCATCGCGTCGCTCGATTCGCAGATCGGACGGATCCGCTCGGGGCACCTGCT
GCTCGCGCTGCTGACCGGGCCGGACCTCGCGCAGTTCGCGCAGCGGATGTCGTCGCAGTTCGCGCGCGTG
CGCGTCGATGACCTGAAGCACAAGTTCGACGAGATCGCCGCGGGTTCGAGCGAGGCCGAGCCGCGGCACG
CGGACGCCGACGTCGCGGTGCCCGACGGCGCCGCCGCTTCGGGCGATGCGCCGCGCGGCCCGTCGAAGAC
GCCGGCGCTCGACACGTACACGACGAACCTCACGCAGCGCGCGCGCGAGGGCAAGATCGACCCGGTGATC
GGCCGCGATGCGGAGATCCGCCAGGCGATCGACATCCTGATGCGCCGCCGGCAGAACAATCCGATCATGA
CGGGCGAGGCGGGCGTGGGCAAGACGGCCGTCGTCGAAGGGCTCGCGCTGCGCATCGCGGCCGACGACGT
GCCGCCGCCGCTTCGCGGCGTCGCGCTGCACGTGCTGGACATGGGCCTCCTGCAGGCGGGCGCGAGCGTG
AAGGGCGAGTTCGAGAATCGCCTGAAGAGCGTGATCGACGAGGTGAAAAAGAGCGCGCATCCGATCATTC
TCTTCATCGACGAGGCGCACACGATCATCGGCGCGGGCGGGCAGGCGGGCCAGAACGATGCGGCGAACCT
GCTGAAGCCGGCGCTCGCGCGCGGCGAGCTGCGCACGATCGCGGCGACGACGTGGAGCGAGTACAAGAAG
TATTTCGAAAAGGACGCGGCGCTTGCGCGGCGCTTCCAGGTGGTGAAGATCGAGGAGCCGAGCGAGCCGC
TCGCCGCCGCGATGCTGCGCGGGATGGCGGCGCTGATGGAGCGGCACTTCAACGTGCGCGTTCTCGACGA
CGCGATCACCGAGGCGGTGCGGCTGTCGCATCGCTATATCAGCGGCCGCCAGTTGCCGGACAAGGCGATC
AGCGTGCTCGACACCGCCTGCGCGAAGGTCGCGCTCGCGCACAGCTCGACGCCCGCGGCGATCGACGACG
CGAAAAAACGCATCGAGCGGATCGACGCGGAAATCGCGGCACTCGAGCGCGAGGCCGCGAGCGGCGCCGC
GCACGATGCGCGCCTCGCCGAACTGCGCGAGGCCCGCGACGCCGATCTGAAGGCGCTGGCCGAGGACGCC
GCGCGCTACGAGGAGGAGCGCGCGCTCGTGACCGAAATCGGCGCGCTGCGCGCCGAGCTCGATGCCGCAC
GCGAGTCGTCCGCCGACGGCAAGCCCGTCGATGTCGACGCGACGCGCGCGAAGCTTGCCGAGCGCGTCGA
TGCGTTGCGCGCGCGGCAGGGCAACCAGCCGATGGTGCCGTTGCAGGTCGACGGCCACGTCGTCGCGGAG
ATCGTCGCGTCGTGGACGGGCATTCCGCTCGGCAGGATGGTGAAGGACGAGATCGAGACCGTGCTGAACC
TGCGCGATCTGCTCGGCGCGCGCGTGATCGGCCAGGACCATGCGCTCGGCGCGATCGCGCAGCGCGTGCG
CACCGCGACCGCGAACCTCGAGGATCCGAACAAGCCGCGCGGCGTGTTCATGTTCGTCGGGCCGTCGGGC
GTCGGCAAGACCGAGACCGCGCTCGCGCTCGCCGACGTGCTGTACGGCGGCGAGCGCAAGCTGATCACGA
TCAACATGAGCGAGTATCAGGAGGCGCACAGCGTGTCGGGCCTGAAGGGCTCGCCGCCCGGCTACGTCGG
CTACGGCGAGGGCGGCGTGCTGACGGAGGCGGTGCGTCGCAATCCGTATTCGGTCGTGTTGCTCGACGAA
GTCGAGAAGGCGCATCCGGACGTGCTCGAGATGTTCTTCCAGGTGTTCGACAAGGGCGCGATGGACGATG
CCGAAGGCCGTGAGATCGACTTTCGCAACACGCTGATCATCCTGACCTCGAACGTCGGCTCGTCGGCGGT
GATGCAGGCGTGCCTGAACAAGGCGCCGCAGGAGTTGCCCGATGCCGAGACGCTTGCCGAGACGCTGCGC
CCGCAGCTCTACAAGACCTTCAAGCCCGCGTTCCTCGGCCGGATGAAGGTGATTCCGTACTATCCGATCT
CCGACGACGTGCTCGCCGAGATCATCGAGCTGAAGCTCGAACGGATTCGCCGCCGGATCGAAGCGAACCA
CAAGGCGGCGTTCGAGTGGGACGAGTCGCTCGTCGACGCCGTGCTCGCGCGCTGCACCGAAGTCGATTCG
GGCGCGCGCAACGTCGATCACATCCTGAACGGCACGCTGCTGCCGGAGATCGCCGAGCTCGTGCTGTCGC
GCATCGCCGATGGCGAGGCGATCGTGCGGATCGCCGCGCGCGCGGCCGAGACGGGCGAATTCGAGTACAC
GGTCGAGTAA
 Primer design