SecReT6
Protein ID: 53720711
SecReT6 ID77
T6SS typei4b
Gene symbol-
Locus tagBPSL3102
StrainBurkholderia pseudomallei K96243
Repliconchromosome I [GenBank: NC_006350] [Browse all T6SS(s) in this replicon]
Location [Strand]3707119..3708219 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ63QC1
KEGG IDbps:BPSL3102
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.10E-94, Aligned region: 18..347
Protein Sequence: 366 a.a.     [Download]
>gi|53720711|ref|YP_109697.1| hypothetical protein BPSL3102 [Burkholderia pseudomallei K96243]
MQTAQRRIDPGVVERLLDEPHRFEFFQAVRLLETWFAKHDAPRHAASRPGEIVARRIGFRNTLSLGFPPS
EIERAQSYDAAGAALKDDVRRNAALEAGALSRVELTPAFFGLLGGQGALPLHYTEQIIAREQLKRDHAAH
AFFDVFSNRATALFYSAWKKYRLPLHYELDRDERYLPLLLALAGVSNDDARSTVQQGRGALLDEAIAGYA
LAARHRPVSAAYLQRTLSEYFRVPIRVEQFVGKWYDVPPDQLSVLGDVNVTLGATALVGERVWQRDMRAR
LVVGPLTKRDYEAFLPGEERAIALERMLTLLAGVTLEYEVSLVLRRAEVGASVLGAGARLGWDAFLCTRE
AGRDRADARYELHVIH
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|53717639|ref|NC_006350.1|:c3708219-3707119 Burkholderia pseudomallei K96243 chromosome 1, complete sequence
ATGCAAACCGCGCAGCGGCGAATCGATCCTGGCGTAGTCGAGCGGCTGCTCGACGAGCCGCATCGCTTCG
AGTTCTTTCAGGCGGTGCGGCTGCTCGAGACCTGGTTCGCGAAGCACGATGCGCCGCGCCACGCGGCGAG
CCGGCCGGGCGAGATCGTCGCGCGGCGCATCGGCTTTCGCAATACGCTGTCGCTCGGCTTTCCGCCGAGC
GAGATCGAGCGCGCGCAGTCGTACGACGCAGCCGGCGCCGCGCTGAAGGACGACGTGCGGCGCAACGCGG
CGCTCGAGGCGGGCGCGCTGTCGCGCGTCGAGCTCACGCCGGCGTTCTTCGGGCTGCTGGGCGGCCAGGG
CGCGCTGCCGCTGCATTACACCGAGCAGATCATCGCGCGTGAGCAACTGAAGCGCGACCATGCCGCGCAC
GCGTTCTTCGATGTCTTCTCGAACCGCGCGACCGCGCTGTTCTATTCGGCATGGAAGAAGTACCGTCTGC
CGCTGCATTACGAACTCGACCGCGACGAGCGCTATCTGCCGCTCCTGCTCGCGCTCGCGGGCGTGTCGAA
CGACGACGCGCGCTCGACCGTGCAGCAGGGCCGCGGCGCGCTGCTCGACGAGGCGATCGCGGGCTATGCG
CTCGCCGCGCGGCATCGGCCGGTATCGGCCGCGTATCTGCAGCGCACGCTGTCCGAATATTTTCGCGTGC
CGATCCGCGTCGAGCAGTTCGTCGGCAAGTGGTACGACGTGCCGCCCGATCAATTGAGCGTGCTCGGCGA
CGTGAACGTGACGCTCGGCGCGACGGCGCTCGTCGGCGAGCGCGTGTGGCAGCGCGACATGCGCGCGCGG
CTCGTCGTCGGCCCGCTGACGAAGCGCGACTACGAGGCGTTCCTGCCCGGCGAGGAGCGCGCGATCGCGC
TCGAGCGGATGCTGACGCTGCTCGCGGGCGTGACGCTCGAATACGAGGTGTCGCTCGTGCTGCGCCGCGC
GGAAGTCGGCGCGAGCGTGCTCGGCGCGGGCGCGCGGCTCGGCTGGGACGCGTTTCTCTGCACGCGCGAA
GCCGGGCGCGATCGTGCGGACGCGCGCTACGAGCTGCATGTCATTCATTGA
 Primer design