SecReT6
Protein ID: 53720712
SecReT6 ID77
T6SS typei4b
Gene symbol-
Locus tagBPSL3103
StrainBurkholderia pseudomallei K96243
Repliconchromosome I [GenBank: NC_006350] [Browse all T6SS(s) in this replicon]
Location [Strand]3708183..3710009 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ63QC0
KEGG IDbps:BPSL3103
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.50E-211, Aligned region: 2..607
Protein Sequence: 608 a.a.     [Download]
>gi|53720712|ref|YP_109698.1| hypothetical protein BPSL3103 [Burkholderia pseudomallei K96243]
MPYYERELSFLRRYSLEFANRYPKIAARLAQTGEQCEDPHVERMIESFALLGARINKKLDDEYPEFTEAL
VEVLYPHYLRPFPSCSIAQFGAPHAFAELTEPRIVERGTELKSRAIRGVQCRFRTAYDVTLAPIRLADAR
YGSVAVAPAAARLPGNATGVISIAFESTSPQLDLAALKLGKLRAHLHGEQSFVAALADCLFAHALACYVE
PDRGGRWIALGKTPFEHAGFDETDALIDYPARSHPAYRLLTEYFAFPDKFNFVDFDLGALARRAGPCRQL
TLHIALRDVRGDSHVARLLDLLSASHFRLFCTPVVNLFRQHGEPIRVDHRAVSYPVIGDARRAFAYEVYS
IDSVHLVRQRADRETLVEFRPFYSLHHGEAAQAGHYWFARRNDDVARKSPGYETEISVVDVDFEPGAPQT
DTLSLDLTCTNRDLPAALATGLDGGDLFIDGGEQPGPIALLRRPTPSARFERGHAAHWRLVSHLALNHVS
LAEEGLAALKEALVLYDLRRSAVSTRHIDGIVGIEQKSAVQWLPGKPFATFVRGVEIRLAIDDEHFVGSS
LATFVRMIDAFFGLYVHLNSFVQLIVVSRRTGEEIMRCKPRSGESILA
 
Nucleotide Sequence: 1827 bp     [Download]
>gi|53717639|ref|NC_006350.1|:c3710009-3708183 Burkholderia pseudomallei K96243 chromosome 1, complete sequence
TTGCCGTATTACGAACGCGAACTGTCGTTTCTGCGGCGCTATTCGCTCGAATTCGCGAACCGTTACCCGA
AGATCGCCGCGCGTCTCGCCCAGACGGGCGAGCAGTGTGAGGATCCGCACGTCGAGCGGATGATCGAATC
GTTCGCGCTGCTCGGCGCGCGGATCAACAAGAAGCTCGACGACGAATATCCCGAGTTCACCGAAGCGCTC
GTCGAAGTCCTCTACCCGCACTATCTGCGGCCGTTCCCGTCATGCTCGATCGCGCAGTTCGGTGCGCCGC
ATGCGTTCGCGGAGCTCACCGAGCCGCGGATCGTCGAGCGCGGCACCGAGCTGAAGAGCCGCGCGATTCG
CGGCGTGCAGTGCCGGTTCCGCACCGCGTACGACGTGACGCTCGCGCCGATCCGGCTCGCCGATGCGCGC
TACGGATCGGTCGCGGTGGCGCCCGCCGCAGCAAGGCTGCCCGGCAACGCGACGGGCGTGATCTCGATCG
CGTTCGAATCGACGTCGCCGCAGCTCGATCTCGCCGCGCTGAAGCTCGGCAAGCTGCGCGCGCATTTGCA
CGGCGAGCAATCGTTCGTCGCCGCGCTGGCCGATTGCCTGTTCGCGCACGCGCTCGCCTGCTACGTCGAG
CCCGATCGCGGCGGCCGCTGGATCGCGCTCGGCAAGACGCCGTTCGAGCACGCGGGCTTCGACGAGACCG
ACGCGCTGATCGACTATCCGGCCCGTTCGCATCCGGCCTATCGGCTGCTGACCGAATACTTCGCATTCCC
GGATAAATTCAACTTCGTCGATTTCGATCTGGGCGCGCTCGCGCGGCGCGCGGGGCCCTGCCGGCAGCTG
ACGCTGCACATCGCGCTGCGCGACGTGCGCGGCGATTCGCATGTCGCGCGGCTGCTCGATCTGCTGAGCG
CGAGCCATTTCCGGCTCTTCTGCACGCCGGTCGTGAACCTGTTCCGCCAGCACGGCGAGCCGATTCGGGT
CGACCACCGGGCGGTGTCGTACCCGGTGATCGGCGATGCGCGCCGCGCGTTCGCGTACGAGGTATATTCG
ATCGATTCGGTGCATCTCGTGCGGCAGCGCGCGGACCGCGAAACGCTCGTCGAATTCCGGCCGTTCTATT
CGCTGCATCACGGCGAAGCCGCGCAGGCCGGCCACTACTGGTTCGCGCGGCGCAACGACGACGTCGCGCG
CAAGAGCCCCGGCTACGAGACCGAGATTTCGGTCGTCGACGTCGACTTCGAGCCGGGCGCGCCGCAAACC
GATACGTTGAGCCTCGATCTCACCTGTACGAACCGCGACCTGCCCGCCGCGCTCGCAACGGGGCTCGACG
GCGGCGATCTCTTCATCGACGGCGGCGAGCAGCCCGGCCCGATCGCGCTATTGCGCCGGCCGACGCCGAG
CGCGCGCTTCGAGCGCGGCCACGCCGCGCACTGGCGCCTCGTGTCGCATCTCGCGCTCAATCACGTGTCG
CTTGCCGAAGAAGGGCTCGCCGCGCTGAAGGAAGCGCTCGTGCTGTACGATCTGAGGCGCTCCGCGGTGT
CGACGCGCCATATCGACGGGATCGTCGGCATCGAGCAGAAGAGCGCGGTGCAATGGCTGCCGGGCAAGCC
GTTCGCGACGTTCGTGCGCGGCGTCGAGATCCGGCTCGCGATCGACGACGAACATTTCGTCGGCTCGAGC
CTCGCGACGTTCGTGCGGATGATCGACGCGTTCTTCGGGCTGTACGTGCACCTCAACAGCTTTGTTCAAC
TGATCGTCGTGTCCAGGCGCACCGGCGAGGAGATCATGCGATGCAAACCGCGCAGCGGCGAATCGATCCT
GGCGTAG
 Primer design