SecReT6
Protein ID: 53720713
SecReT6 ID77
T6SS typei4b
Gene symbol-
Locus tagBPSL3104
StrainBurkholderia pseudomallei K96243
Repliconchromosome I [GenBank: NC_006350] [Browse all T6SS(s) in this replicon]
Location [Strand]3710101..3710613 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ63QB9
KEGG IDbps:BPSL3104
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.10E-21, Aligned region: 39..147
Protein Sequence: 170 a.a.     [Download]
>gi|53720713|ref|YP_109699.1| hypothetical protein BPSL3104 [Burkholderia pseudomallei K96243]
MPRSRFACCPMKRFEPSFLDKLFDDEPHVPAPAAMRQLSLEELKNTVARDVEAILNTRIALTEEDLAELP
ECQRSVLTYGLNDFAGLSLASHYDRTFICKSIQQAIARHEPRLQQVQVAFELNEQSTNALYFAIQALLVV
HPAEEPVTFDAMLQPSTLQYSVTRSRAAKV
 
Nucleotide Sequence: 513 bp     [Download]
>gi|53717639|ref|NC_006350.1|:c3710613-3710101 Burkholderia pseudomallei K96243 chromosome 1, complete sequence
GTGCCCCGTTCCCGTTTTGCTTGCTGCCCGATGAAACGTTTCGAACCGAGCTTCCTCGACAAGCTGTTCG
ACGACGAACCGCACGTGCCGGCGCCCGCCGCGATGCGGCAGTTGTCGTTGGAGGAGCTGAAGAACACGGT
CGCGCGCGACGTCGAGGCGATCCTCAACACGCGCATCGCGCTGACCGAAGAAGATCTCGCCGAGCTGCCC
GAATGCCAGCGCTCGGTGCTGACCTACGGGCTGAACGATTTCGCCGGCCTGAGCCTCGCGAGCCACTACG
ATCGCACGTTCATCTGCAAATCGATTCAGCAGGCGATCGCGCGGCACGAGCCGAGGCTGCAGCAGGTGCA
GGTGGCGTTCGAGCTGAACGAGCAGTCGACGAACGCGCTCTATTTCGCGATCCAGGCGCTGCTCGTCGTG
CATCCCGCCGAGGAACCGGTGACCTTCGATGCGATGCTGCAGCCGTCGACGTTGCAATATTCGGTGACGC
GTTCGCGCGCCGCCAAGGTGTGA
 Primer design