SecReT6
Protein ID: 53720715
SecReT6 ID77
T6SS typei4b
Gene symbol-
Locus tagBPSL3106
StrainBurkholderia pseudomallei K96243
Repliconchromosome I [GenBank: NC_006350] [Browse all T6SS(s) in this replicon]
Location [Strand]3711217..3712707 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ63QB7
KEGG IDbps:BPSL3106
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.60E-189, Aligned region: 67..491
Protein Sequence: 496 a.a.     [Download]
>gi|53720715|ref|YP_109701.1| hypothetical protein BPSL3106 [Burkholderia pseudomallei K96243]
MNQQTAAAQSTGVQAGTESSLLDEIVEKSKVAKSESEHARAKDLIGELVSQVLDGTVVVSDNLSATIDAR
VAELDRLISSQLSAVMHAAEFQRLESTWRGLDYLVKESNTGSTIKIKALHAPKRDLVRDFKNATEFDQSA
LFKKVYEEEFGTFGGSPFGVLVGDYEISRQPEDQYFIEQMSHVAAAAHAPFIASAAPELLGLESFADLGK
PRDLGKVFDTVEYAKWKSFRDSEDSRYVGLTLPRFLGRLPFNPKDGAIAESFNFVEDVDGTDHDKYLWCN
ASWAFAARLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEIALKCPTEIAITDRREKELSDLGFI
PLVHCKNSDYAAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRIAHYLKAMMRDKIGSFASAQNV
ETFLNRWISQYVLLDDDATQEQKAQFPLREASVQVSEIPGKPGAYRSVAFLRPHFQLDELSISLRLVADL
PKPANS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|53717639|ref|NC_006350.1|:c3712707-3711217 Burkholderia pseudomallei K96243 chromosome 1, complete sequence
ATGAACCAGCAAACGGCTGCGGCCCAATCCACCGGCGTTCAAGCCGGCACGGAATCCTCGCTGCTCGACG
AGATCGTCGAGAAGAGCAAGGTCGCGAAATCCGAATCCGAGCATGCGCGCGCGAAGGATCTGATCGGCGA
GCTCGTCAGTCAGGTGCTTGACGGCACGGTGGTGGTGTCGGACAACCTGTCGGCGACCATCGACGCGCGC
GTCGCGGAGCTCGATCGCCTGATCTCGTCGCAGCTCTCGGCCGTGATGCACGCGGCGGAGTTCCAGCGTC
TCGAGAGCACCTGGCGCGGGCTCGATTACCTGGTGAAGGAAAGCAACACCGGCTCGACGATCAAGATCAA
GGCGCTGCACGCGCCGAAGCGCGATCTCGTGCGCGATTTCAAGAACGCGACCGAGTTCGATCAGAGCGCG
CTCTTCAAGAAGGTGTACGAAGAGGAATTCGGCACGTTCGGCGGCTCGCCGTTCGGCGTGCTGGTGGGCG
ACTACGAGATCTCGCGCCAGCCGGAAGACCAGTACTTCATCGAGCAGATGTCGCACGTCGCGGCCGCCGC
GCACGCGCCGTTCATCGCGTCGGCGGCGCCCGAGCTGCTCGGGCTCGAATCGTTCGCGGATCTCGGCAAG
CCGCGCGATCTCGGCAAGGTGTTCGATACCGTTGAATACGCGAAGTGGAAGTCGTTCCGCGATTCCGAGG
ATTCGCGCTACGTCGGCCTCACGCTGCCGCGCTTTCTCGGCCGCCTGCCGTTCAATCCGAAGGACGGCGC
GATCGCGGAGAGCTTCAACTTCGTCGAGGACGTCGACGGCACCGATCACGACAAGTACCTGTGGTGCAAC
GCGTCGTGGGCGTTCGCCGCGCGCCTGACGGCGGCGTTCGACGACTTCGGCTGGTGCGCGGCGATTCGCG
GCGTCGAAGGCGGCGGCCTCGTCGAGGATCTGCCGACCCACACGTTCAAGACCGACGACGGCGAAATCGC
GCTCAAGTGCCCGACCGAGATCGCGATCACCGACCGCCGCGAGAAGGAACTGAGCGATCTCGGTTTCATC
CCGCTCGTGCACTGCAAGAATTCCGATTACGCCGCGTTCTTTGCCGCGCAGTCGGTGCAGAAACCCAAGA
AATACAGCACCGACAGCGCCAACGCGAACGCCGTCCTGTCCGCTCAGCTGCAGTACATCTTCTCGGTATC
GCGCATCGCGCATTACCTGAAGGCGATGATGCGCGACAAGATCGGCAGCTTCGCGTCCGCGCAGAACGTC
GAAACGTTCCTCAATCGCTGGATCTCGCAGTACGTGTTGCTCGACGACGACGCGACGCAGGAACAGAAGG
CGCAGTTCCCGCTGCGCGAGGCCTCCGTACAAGTGTCAGAGATTCCGGGCAAGCCGGGTGCGTATCGTTC
GGTCGCGTTTTTGCGTCCGCACTTCCAGCTCGACGAGTTGTCGATTTCTCTGCGCCTTGTCGCTGATCTG
CCCAAACCGGCAAATTCATAA
 Primer design