SecReT6
Protein ID: 53720718
SecReT6 ID77
T6SS typei4b
Gene symbol-
Locus tagBPSL3109
StrainBurkholderia pseudomallei K96243
Repliconchromosome I [GenBank: NC_006350] [Browse all T6SS(s) in this replicon]
Location [Strand]3714325..3714939 [+]
Productlipoprotein
NoteTssJ
UniProt IDQ63QB4
KEGG IDbps:BPSL3109
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.40E-37, Aligned region: 15..176
Protein Sequence: 204 a.a.     [Download]
>gi|53720718|ref|YP_109704.1| lipoprotein [Burkholderia pseudomallei K96243]
MNPHVTRYALPLAACILLGGCAAAVPLLGSAGSAALQMVGVGKPDVPDSQKPPRNLGLTLYAAQNLNAAN
DNRPLALVVRLYALKDPTSFQQAPFDSFTDPTKEKTALGADLLSVREITLIPGQHYNATEKVSREAQAFG
VVALFRDPALQRWKLTFDPAKSEKSGIIIGLHNCAMTVTGGTVIPSQQGMPTQRLDLLSSVNCG
 
Nucleotide Sequence: 615 bp     [Download]
>gi|53717639|ref|NC_006350.1|:3714325-3714939 Burkholderia pseudomallei K96243 chromosome 1, complete sequence
ATGAATCCGCATGTGACTCGTTACGCGCTGCCGCTCGCCGCCTGCATTCTGCTCGGCGGCTGCGCGGCCG
CCGTGCCGCTCCTCGGTTCGGCGGGCAGCGCCGCGCTGCAGATGGTGGGCGTCGGCAAACCCGACGTGCC
CGATTCGCAGAAGCCGCCGCGCAATCTCGGCCTCACGCTCTATGCGGCACAGAACCTCAACGCCGCGAAC
GACAACCGTCCGCTCGCGCTCGTCGTGCGCCTCTACGCGCTGAAAGATCCGACGTCGTTCCAGCAGGCGC
CGTTCGACAGCTTCACCGATCCGACGAAAGAAAAGACCGCGCTCGGCGCCGATCTGCTGAGCGTGCGCGA
AATCACGCTGATTCCGGGGCAGCACTACAACGCGACCGAAAAGGTGTCGCGCGAAGCGCAGGCATTCGGC
GTCGTCGCGCTTTTTCGCGATCCGGCGCTACAACGCTGGAAACTAACTTTCGATCCGGCGAAATCCGAGA
AATCCGGCATAATCATTGGCCTGCACAACTGCGCGATGACCGTGACGGGCGGCACCGTCATCCCTTCGCA
GCAAGGCATGCCGACGCAGCGGCTCGATTTGCTGTCGTCGGTGAACTGCGGGTGA
 Primer design