SecReT6
Protein ID: 53720719
SecReT6 ID77
T6SS typei4b
Gene symbol-
Locus tagBPSL3110
StrainBurkholderia pseudomallei K96243
Repliconchromosome I [GenBank: NC_006350] [Browse all T6SS(s) in this replicon]
Location [Strand]3715048..3716394 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ63QB3
KEGG IDbps:BPSL3110
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.60E-135, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|53720719|ref|YP_109705.1| hypothetical protein BPSL3110 [Burkholderia pseudomallei K96243]
MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGVRSVRFDRDALGSNVLRASELSLVFP
DGALYSAPQADELPPPIALDTLPEGINEFTFYLALHPLRETGSNYADDRDAGFVSRFVSEQASVADHFTD
AAEADITFLKTNVKLIAHSEPRDQLLSIPLVRVRRTATSGFEIDDGFVPPCLAIEASPILHQRLRQLIDA
LQAKVNALYGFHREPTKNIIEFRSGDIASFWLLHTASAAFAALAHLHQHSALHPERLFQELLRLAGQLMT
FSKGYVLADLPAYRHDDPGPGFARLDSILRELLETVISTRYFAITLEEVRPSFHVGRLDSGKIDDKTAFY
LAVSADMPSVELVDAVPARFKVGAPDDVDKLVLSAMPGVRLAYTPQVPPAIPVRPGACYFALDARSPLYE
RMLQAQSAMIYAPSGINDLKFELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|53717639|ref|NC_006350.1|:3715048-3716394 Burkholderia pseudomallei K96243 chromosome 1, complete sequence
ATGAGTTATTCGGCCAAGGTGCTCTGGGGAGAAGGCCTCTTTCTGAGGCCGCAGCACTTTCAGCGGCAGG
ACGCGTATCACGAAGCGCGCCTGTTCGAATCGATCCAGGCGATCCAGCCGTACAACTGGGGCGTGCGTTC
GGTGCGGTTCGATCGCGACGCGCTCGGCAGCAACGTGCTGCGCGCGAGCGAACTGTCGCTCGTGTTTCCG
GACGGCGCGCTCTACTCCGCGCCGCAAGCCGACGAACTGCCGCCGCCCATCGCGCTCGACACGCTGCCCG
AAGGCATCAACGAATTCACGTTCTACCTCGCGCTGCACCCGCTGCGCGAGACCGGCTCGAACTACGCGGA
CGACCGCGACGCCGGCTTCGTGTCGCGCTTCGTCAGCGAACAGGCGAGCGTTGCCGATCACTTCACCGAC
GCCGCGGAAGCGGACATCACGTTCCTGAAGACGAACGTGAAGCTGATCGCGCACAGCGAGCCGCGCGACC
AGTTGCTGTCGATCCCGCTCGTACGCGTGCGCCGCACCGCGACGTCCGGCTTCGAGATCGACGACGGCTT
CGTGCCGCCGTGCCTCGCGATCGAGGCGTCGCCGATCCTGCACCAGCGCCTGCGCCAGTTGATCGACGCG
CTGCAGGCGAAGGTGAATGCACTGTACGGTTTCCATCGCGAGCCGACGAAGAACATCATCGAGTTCCGCT
CGGGCGACATCGCATCGTTCTGGCTGCTGCACACGGCGAGCGCCGCGTTCGCCGCGCTCGCGCACCTGCA
CCAGCATTCGGCCTTGCATCCGGAGCGGCTGTTCCAGGAACTACTGCGCCTCGCGGGCCAGTTGATGACG
TTCTCGAAGGGCTACGTGCTCGCCGATCTGCCCGCGTACCGGCATGACGATCCGGGCCCGGGCTTCGCGC
GGCTCGATTCGATCCTGCGCGAGCTGCTCGAGACCGTGATCTCGACGCGCTACTTCGCGATCACGCTCGA
GGAAGTGCGGCCGTCGTTCCATGTCGGGCGGCTCGACTCGGGCAAGATCGACGACAAGACCGCGTTCTAT
CTCGCGGTGTCGGCCGACATGCCGTCGGTCGAACTCGTCGATGCGGTGCCCGCGCGCTTCAAGGTGGGCG
CGCCGGACGACGTCGACAAGCTCGTGCTCTCCGCGATGCCGGGCGTGCGCCTCGCGTACACGCCGCAGGT
GCCGCCCGCGATTCCCGTGCGCCCGGGCGCATGCTATTTCGCACTCGATGCGCGCAGCCCGCTCTATGAG
CGGATGCTGCAGGCCCAGTCGGCGATGATCTATGCGCCGTCCGGAATCAACGATCTCAAATTCGAACTGA
TCGCCGTCACGTCATGA
 Primer design