SecReT6
Protein ID: 53721133
SecReT6 ID72
T6SS typei3
Gene symbol-
Locus tagBPSS0095
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]115016..115672 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ63P51
KEGG IDbps:BPSS0095
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 8.30E-30, Aligned region: 2..194
Protein Sequence: 218 a.a.     [Download]
>gi|53721133|ref|YP_110118.1| unnamed protein product [Burkholderia pseudomallei K96243]
MLLQDTMLHVALLTQGARISRVHDWRARCIALVRQFEQALQDGGYRSGIANELGLAQCVFLDEITMRNLS
TEQKEEWLRELLQFRFHSIRDGLSKVRARIDRLCRGHSANAALLEMYSLFHEFGLLGDKQGHALADARVS
EARPTPGKKAAETAEIWKDGGAANEAAHGRSWRIVGGLLAFAALMTMWLVIDTRLSHEVEQMEVTSGDEA
AIHPASGD
 
Nucleotide Sequence: 657 bp     [Download]
>gi|53721039|ref|NC_006351.1|:115016-115672 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGTTATTGCAGGACACGATGCTCCATGTCGCGCTATTGACGCAAGGCGCGCGCATATCGCGCGTGCATG
ACTGGCGCGCGCGCTGCATCGCGCTCGTCAGGCAATTCGAGCAGGCGCTGCAGGACGGCGGCTACCGCAG
CGGTATTGCCAATGAATTGGGCCTCGCGCAATGCGTTTTTCTGGACGAGATCACGATGCGCAATCTGTCG
ACCGAGCAAAAGGAAGAATGGTTGCGTGAGCTCCTTCAGTTCCGTTTCCACTCGATTCGGGATGGGTTGA
GCAAAGTGCGTGCGCGTATCGATCGCCTTTGCCGCGGGCATTCGGCGAATGCCGCATTGCTGGAAATGTA
TTCGTTGTTCCATGAATTCGGTCTCCTGGGAGACAAGCAAGGGCACGCGTTAGCCGACGCGCGGGTGTCG
GAGGCAAGGCCGACGCCCGGAAAGAAAGCCGCGGAAACGGCGGAGATTTGGAAGGACGGGGGGGCCGCCA
ATGAAGCGGCGCACGGACGCTCTTGGCGAATCGTCGGCGGCCTGCTGGCGTTTGCGGCGCTCATGACGAT
GTGGCTCGTTATCGACACACGTCTGAGCCATGAAGTGGAACAGATGGAAGTCACGTCCGGAGATGAAGCA
GCGATTCATCCGGCATCGGGGGATTGA
 Primer design