SecReT6
Protein ID: 53721134
SecReT6 ID72
T6SS typei3
Gene symbol-
Locus tagBPSS0096
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]115675..117351 [+]
ProductOmpA family protein
NoteTagL
UniProt IDQ63P50, Q63P50
KEGG IDbps:BPSS0096
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 1.00E-18, Aligned region: 441..537
DUF218 [PF02698], Evalue: 0.00058, Aligned region: 446..517
Protein Sequence: 558 a.a.     [Download]
>gi|53721134|ref|YP_110119.1| unnamed protein product [Burkholderia pseudomallei K96243]
MSRQIRFWLVWGAIPFVVLASLCLPLRMQPDWSHVLTIVLIIAAIVLAIEIFEHSRETAQDRAAEAEIDD
HELAVIIVAGPHASSLFNSSGDDTAFRREAGALWLRADSVEQLRDTMMRVKASRGRFPDAAVVPLVSESD
DESDMRQAFAKWRTELREALCYPDAAYVLPCYLAVYTCLGFKGADGARPKWTGDAIEIGTRQMNAASKVG
ELLASIRQQLLRPSPTGSSAQCALGLGVFDWLDATALLSSMTMLANTPPFMLKGLTLANVGRRPIRPGAW
TRWLTVRTGLHIRQTKSSMAPLPVPRVAKHAESGIREGWSSARHLVSTRASFVPALVFSTVSTLGIAVAV
SGWMNSRMIQRVSNDIADYRSGADEWIGRKRFAQARLEHDRTAIVQTLLDGVPTGFGWGLYRGQELLVKL
DTVLDSPRTASIAMQLDTVSLFAAGKATFSPGAAQRELQHALRMILANPEQRVLIVGHADSSGSDAANFQ
LSEARARAIRDWFVDQGVLKTRFIVQGAGDTHPIADNDSPSGRAQNRRVEVLLIPDVASDRKASGTGL
 
Nucleotide Sequence: 1677 bp     [Download]
>gi|53721039|ref|NC_006351.1|:115675-117351 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGTCGCGTCAGATTCGATTTTGGCTCGTATGGGGCGCCATACCCTTCGTGGTGCTCGCGAGCCTTTGCC
TGCCGTTGCGCATGCAGCCGGATTGGTCTCATGTGCTGACCATCGTTCTGATCATTGCCGCCATCGTGCT
GGCGATCGAAATATTCGAACACTCTCGCGAGACAGCGCAAGACCGAGCGGCCGAAGCCGAAATCGACGAT
CACGAGCTGGCGGTGATCATCGTCGCGGGCCCTCACGCATCGTCGCTTTTCAATAGCAGCGGGGACGATA
CGGCGTTTCGGCGCGAAGCCGGCGCGTTATGGCTGCGCGCCGACAGCGTCGAGCAATTGCGAGACACGAT
GATGCGCGTCAAGGCGTCGCGCGGACGGTTCCCGGACGCCGCCGTGGTGCCGCTCGTATCGGAAAGCGAT
GACGAAAGCGACATGAGGCAGGCGTTCGCGAAGTGGCGAACCGAACTCCGCGAAGCGCTTTGCTATCCCG
ATGCGGCCTATGTCCTGCCTTGCTATCTCGCCGTCTACACGTGTCTTGGATTCAAGGGAGCCGACGGCGC
GCGTCCGAAGTGGACGGGCGATGCAATAGAAATCGGCACGAGGCAGATGAATGCCGCATCGAAAGTGGGC
GAGCTGCTCGCATCGATTCGACAACAACTGCTTCGGCCGTCGCCCACCGGTTCGTCGGCGCAGTGCGCGC
TGGGGCTCGGCGTGTTCGATTGGCTCGACGCCACGGCGCTGCTGTCGTCGATGACCATGCTGGCGAATAC
CCCGCCATTCATGCTGAAAGGGCTGACGCTCGCGAATGTCGGCAGACGGCCGATACGTCCGGGAGCGTGG
ACGCGCTGGCTCACTGTTCGGACCGGTCTCCATATTCGCCAGACCAAATCGTCGATGGCGCCGCTTCCCG
TGCCGCGCGTGGCGAAGCATGCCGAAAGCGGCATTCGGGAAGGATGGAGCAGCGCGCGCCATCTCGTTTC
CACTCGTGCGAGCTTCGTGCCGGCGCTCGTGTTCTCCACTGTTTCGACGCTGGGCATCGCCGTGGCGGTC
TCGGGCTGGATGAACAGCCGCATGATCCAGCGGGTGTCGAACGATATCGCGGATTATCGGAGCGGAGCCG
ACGAGTGGATCGGGAGGAAGCGCTTTGCGCAGGCCCGCCTCGAACACGATCGCACGGCGATCGTGCAGAC
GCTGCTCGATGGCGTACCGACCGGTTTCGGCTGGGGACTCTACCGGGGGCAGGAGTTGCTGGTCAAGCTC
GATACGGTGCTGGATTCGCCGCGCACGGCGTCGATCGCGATGCAGCTCGACACGGTATCGCTGTTCGCCG
CGGGCAAGGCTACATTTTCTCCGGGCGCCGCGCAGCGTGAGTTGCAACATGCATTGCGGATGATTCTCGC
CAATCCGGAACAACGTGTGCTGATCGTCGGTCATGCAGACAGCTCCGGCTCGGATGCGGCCAATTTTCAG
TTATCCGAAGCGCGTGCGCGCGCGATTCGTGACTGGTTCGTCGATCAAGGCGTGCTGAAGACGCGCTTCA
TCGTGCAAGGAGCCGGCGATACGCATCCGATCGCCGATAACGACAGCCCTTCGGGACGTGCGCAGAATCG
CCGTGTCGAGGTCTTGCTGATTCCGGACGTTGCTTCCGACAGGAAGGCGAGCGGTACGGGACTATAG
 Primer design