SecReT6
Protein ID: 53721135
SecReT6 ID72
T6SS typei3
Gene symbol-
Locus tagBPSS0097
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]117729..118268 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ63P49
KEGG IDbps:BPSS0097
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.50E-61, Aligned region: 11..163
Protein Sequence: 179 a.a.     [Download]
>gi|53721135|ref|YP_110120.1| unnamed protein product [Burkholderia pseudomallei K96243]
MAISNSSQKFIARNRAPRVQIEYDVEIYGSEKKVELPFVMGVLADLSGKPLEPLPAVGDRKFFSIDIDNF
DERMKAMKPRVAFSVPNTLSGDGQLMVDITFESMDDFSPAAIAKKVDALSQLLDARTQLANLQTYMDGKS
GAENLVSKVLKDPALLSALAKAPKPVAEQAENRESKEKH
 
Nucleotide Sequence: 540 bp     [Download]
>gi|53721039|ref|NC_006351.1|:117729-118268 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGGCTATATCCAATAGCTCACAGAAATTTATCGCGCGCAATCGTGCGCCTCGCGTTCAGATCGAATATG
ACGTCGAGATTTACGGCTCCGAAAAGAAGGTCGAGCTTCCGTTCGTGATGGGCGTGCTCGCGGACCTGTC
GGGCAAGCCGCTCGAGCCTCTGCCGGCGGTCGGCGACCGCAAGTTCTTCAGCATCGATATCGACAATTTC
GACGAGCGCATGAAGGCGATGAAGCCGCGTGTCGCGTTCTCGGTGCCGAATACTCTTTCCGGCGACGGTC
AATTGATGGTCGACATCACGTTCGAAAGCATGGACGACTTTTCTCCCGCGGCGATCGCGAAGAAGGTGGA
TGCGTTGTCGCAATTGCTGGACGCGCGCACGCAGCTTGCCAATCTGCAGACCTACATGGACGGAAAGTCG
GGCGCGGAGAACCTCGTGAGCAAGGTGCTCAAGGACCCCGCGCTGCTGAGCGCGCTTGCGAAGGCGCCGA
AGCCCGTGGCGGAACAGGCGGAAAACAGGGAATCGAAGGAAAAGCACTGA
 Primer design