SecReT6
Protein ID: 53721137
SecReT6 ID72
T6SS typei3
Gene symbol-
Locus tagBPSS0099
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]120001..120483 [+]
Producthypothetical protein
NoteTssD
UniProt IDQ63P47
KEGG IDbps:BPSS0099
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.90E-41, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|53721137|ref|YP_110122.1| unnamed protein product [Burkholderia pseudomallei K96243]
MSHDIFLKINGIDGEAEDATHKGEIEVLSWSWNVSQQSNMHLGSGGGAGKATIDDLQFEHYIDRASPNLV
QYCLLGKHIDEARLVVRKAGGSPLEYIKLTMSDVLVTQVSPTGVAQDESRPRELVRLSFSRLKQEYVVQN
PQGGSGGAITATFDIKKNAA
 
Nucleotide Sequence: 483 bp     [Download]
>gi|53721039|ref|NC_006351.1|:120001-120483 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGTCGCACGACATTTTCCTCAAGATCAACGGTATCGATGGCGAGGCGGAAGACGCAACCCACAAGGGCG
AAATCGAGGTCTTGAGCTGGTCGTGGAACGTCAGTCAGCAATCGAACATGCACCTGGGTTCGGGGGGCGG
CGCGGGCAAGGCGACGATCGATGATCTGCAGTTCGAACATTACATCGATCGCGCGAGCCCGAATCTCGTT
CAATACTGCTTGCTCGGCAAGCATATCGACGAAGCCCGGCTCGTGGTGCGTAAGGCGGGCGGCAGCCCGC
TCGAATACATCAAGCTCACGATGAGCGATGTGCTCGTTACGCAGGTGAGCCCGACAGGCGTGGCTCAGGA
CGAATCGCGCCCGCGTGAGCTCGTTCGGCTGTCGTTCTCGCGCCTGAAGCAAGAGTATGTCGTCCAGAAC
CCGCAGGGCGGCAGCGGCGGCGCAATCACCGCGACTTTCGACATCAAGAAGAACGCGGCGTAA
 Primer design