SecReT6
Protein ID: 53721138
SecReT6 ID72
T6SS typei3
Gene symbol-
Locus tagBPSS0100
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]120671..121153 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ63P46
KEGG IDbps:BPSS0100
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.10E-36, Aligned region: 7..154
Protein Sequence: 160 a.a.     [Download]
>gi|53721138|ref|YP_110123.1| unnamed protein product [Burkholderia pseudomallei K96243]
MAAMVCTSLAACASLPARKETADLIVKIKVSEGANPDEHQRPAPVMVRLYELKSAGAFENADFFTLQSDS
RKVLGDDAIATDEFVMRPGDTRDIHRRADSAGTSVGVLVGYRELGKSVWRAVHKLRPAPEDAWYRAFTPR
TKIKLNVDVGQQTVTITELE
 
Nucleotide Sequence: 483 bp     [Download]
>gi|53721039|ref|NC_006351.1|:120671-121153 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
GTGGCGGCAATGGTATGCACATCGCTCGCGGCTTGCGCAAGCTTGCCGGCACGCAAGGAAACAGCCGATC
TGATCGTGAAGATCAAGGTGAGCGAAGGCGCCAATCCGGATGAGCATCAGCGCCCGGCGCCCGTGATGGT
GCGGCTGTACGAGCTGAAATCGGCCGGCGCGTTCGAGAACGCCGATTTTTTCACGCTACAGAGCGACAGC
CGCAAGGTGTTGGGTGACGACGCGATCGCGACGGATGAATTCGTGATGCGCCCGGGCGACACCCGGGATA
TTCATCGGCGTGCCGATTCCGCGGGGACGTCGGTCGGCGTGCTGGTCGGTTATCGAGAGCTCGGCAAATC
GGTGTGGCGGGCGGTCCATAAGCTGCGGCCGGCTCCGGAGGATGCATGGTACCGGGCATTCACGCCAAGG
ACGAAAATCAAGTTGAACGTCGATGTCGGGCAGCAGACGGTGACGATTACAGAATTGGAATGA
 Primer design