SecReT6
Protein ID: 53721139
SecReT6 ID72
T6SS typei3
Gene symbol-
Locus tagBPSS0101
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]121159..122508 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ63P45
KEGG IDbps:BPSS0101
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.70E-143, Aligned region: 20..447
Protein Sequence: 449 a.a.     [Download]
>gi|53721139|ref|YP_110124.1| unnamed protein product [Burkholderia pseudomallei K96243]
MSWHNKVVWNEGLFLLPQLFQQQERYFEYFAHKRAAVLSPFFWGFSRYEIDQESLSFGKLVFKSGAGIFP
DGTPFDVPGHTPPPPPLTIAAEHQDQVIYLAVPLRLPNTEETAFDEQAGSLARYSAFEIELRDSNAIGQG
PKPVQLANMRLRLLPEKELTQSWIGIALTRVKTLHADGSVALYDGDHIPPVSQYGANPLLREWATQLHGL
AKLRADALATRLSGSDGRAGAAAEVADYLLLQVLNRYEPLLEHICRIREMPPVTLYRELSMLAGELSTFV
RPQTRRPRPTPGYDHAQLYASIRPLVDEVHYLLNQVLIRGAQPIPLTEQPHGIRVATMLPSELAGYSSLV
LAVGAQMSPDVLQQQFASQTKISHPQRLPELIRSHLPGMTMIPLPVPPRQIPFNSSYIYYELSRTGPFWE
QIAQQGGLAMHIAGHFPELKLELWGVRHK
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|53721039|ref|NC_006351.1|:121159-122508 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGAGTTGGCATAACAAAGTGGTGTGGAACGAAGGACTGTTTCTTCTTCCCCAGCTGTTTCAACAACAGG
AACGGTATTTCGAATATTTCGCGCACAAGCGGGCCGCGGTCCTCAGCCCGTTTTTCTGGGGATTCAGCCG
ATACGAAATCGATCAGGAGTCGCTATCGTTCGGCAAGCTCGTGTTCAAGAGCGGTGCGGGAATATTTCCC
GACGGAACGCCGTTCGACGTGCCGGGGCACACGCCGCCGCCGCCGCCGCTGACGATTGCCGCCGAGCATC
AGGATCAGGTGATTTATCTCGCGGTGCCGCTGCGTCTGCCGAATACGGAGGAGACCGCGTTCGACGAACA
AGCGGGATCGCTTGCGCGCTATTCGGCGTTCGAGATCGAATTGCGCGACAGCAATGCGATCGGTCAAGGG
CCCAAGCCGGTACAGCTCGCGAACATGCGGCTGCGCCTGCTGCCGGAAAAGGAGCTGACGCAGTCCTGGA
TCGGTATTGCCTTGACGCGCGTGAAGACGCTTCACGCCGACGGTTCGGTCGCGCTGTACGACGGTGACCA
CATCCCGCCCGTCAGCCAGTACGGAGCGAACCCGCTGCTGCGCGAATGGGCGACCCAGTTGCACGGCCTC
GCGAAACTGCGAGCCGACGCGCTGGCGACGCGCCTGTCCGGCAGCGATGGCCGGGCCGGGGCGGCGGCCG
AGGTGGCGGATTATTTGTTGCTGCAGGTGCTGAACCGGTATGAACCGCTGCTCGAGCACATCTGCAGGAT
TCGCGAAATGCCGCCCGTCACGCTCTATCGCGAGCTGTCGATGCTGGCAGGCGAATTGTCGACGTTCGTG
CGCCCGCAAACGCGCCGTCCGCGGCCGACGCCCGGTTACGATCATGCGCAGTTGTATGCGAGCATTCGCC
CGCTGGTCGACGAGGTGCACTACCTGTTGAACCAGGTTCTGATTCGAGGCGCGCAGCCGATCCCGCTCAC
CGAGCAGCCGCACGGCATTCGCGTGGCCACGATGTTGCCGTCGGAACTCGCGGGCTATTCGAGCCTCGTG
CTCGCCGTGGGCGCGCAAATGTCGCCGGACGTGTTGCAGCAGCAGTTCGCATCCCAGACGAAGATCAGCC
ATCCGCAGCGGCTGCCGGAGCTCATTCGCTCTCATTTGCCGGGCATGACGATGATTCCGTTGCCGGTGCC
TCCGCGGCAGATTCCGTTCAATTCCAGCTATATCTATTACGAGCTATCCCGCACGGGGCCGTTCTGGGAA
CAGATTGCGCAACAAGGCGGGCTGGCGATGCACATCGCGGGCCACTTCCCTGAACTCAAGCTCGAACTTT
GGGGAGTGCGTCACAAATGA
 Primer design