SecReT6
Protein ID: 53721141
SecReT6 ID72
T6SS typei3
Gene symbol-
Locus tagBPSS0103
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]123821..127729 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ63P43
KEGG IDbps:BPSS0103
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.30E-97, Aligned region: 42..57
ImcF-related_N [PF14331], Evalue: 1.30E-97, Aligned region: 264..541
IcmF-related [PF06761], Evalue: 2.50E-91, Aligned region: 393..495
IcmF-related [PF06761], Evalue: 2.50E-91, Aligned region: 590..913
DUF1215 [PF06744], Evalue: 3.10E-33, Aligned region: 1036..1159
Protein Sequence: 1302 a.a.     [Download]
>gi|53721141|ref|YP_110126.1| unnamed protein product [Burkholderia pseudomallei K96243]
MSYLKRFLRFVFSWQMLACIAVLLVCAAVWFVGPLLAFDELRPLAGVVVRVAVIVLLVALLAFWLLRWPL
SPIGVAALCLLIWHAGPLFAFGDHRPFGPAWVRVLIVAAMLFCYAVYGLYRLWRAVRTNDALLKRILEPS
AGKPDAAAQANIRAVSVAVSKAIGQLKRLRGGAFGWRRLLESGRYLYELPWYMVVGAPGAGKSAAIARSG
LKFPLADQMEASSERARGGTANCEWWFANEAVLIDTAGRYVRHEVPGDEEATVANGAEWKGFLGLLRKHR
PRAPVNGVVLSVSVEELVGRTPAERTAHAATLRARLGELHQELGIHFPVYVIVTKLDLLPGFPEYFQSLT
AEGRTQIWGFTLPYDAENRRSAVGALREHCADELKRLEMRIDAGLNNRLLEEYENDRRKRLYALPQEFRS
LSAALSDMLALVFLDSRYDDAQLQNTLRGVYFTSAEQTDQVLAADRETILQRLKRQLGRMLGGDAGAQTR
DSGAVSGSRGYFLRDVFQHVIVPEAHLVRPNVRWEVRFRLMRWAGHLLAVALLVWLASALTVSFDNNRGY
LDAISEKTAALAARVNAYNKAPKPAQIGGVLDGARDLPQHGNLDLDAPGASFRYGLYVAPGIVDASDATY
RSLLRRSLLPQIVRRVEDALSAQIDAKHADEVYRTLTVYLMLDDAARHDAKAVKDWVMRDWERSDSAAEM
GGRNLMARHLDALFVDARPFEPSGHRNAALVQRARLFLNANPAPRRLYERAMAAIEKEAPENFTLARAVG
LQGAGIFRLADGSRFQRGMPGLYTYDGYHQVFSARLPEFLARAQSDDAWVMGNAGPAARWGDAIRNTQAV
AGRSSLADDIRRQYLTDYGNYWQQYLADIRPASSGEDGAGGTLAFDLATLRALAAPDSPLVRLARAVVRE
TSLSVVDAREDASLTDAALSSLGRRSGAAKEVADGAQKLAARRPEQRLEKELVDNRFAALREVVTGQADT
GSGPAMTDVPVAAGGRALQLDAILTLINEQYTRLVVADNALSSQSMPPALDIGTTLQMEAEKLPAPLRTV
LGGIATQAADKVGREVGSLLAMQVDSSVGNACRAAVDGKYPFARSAQEVDIEDFNRLFAAGGLFDAFFQK
ALAPHVDTHSKPWRYKALNPGMPPIRGPSLEPFERAAAIRDVFFREPGAKRMAWRMDAKVASIDPEITEL
IVDVDGQSQRYVHGPVLPFSVNWPGPRGGAIAEITAKPRIRPDTSTIATTGPWALFRLIERGRLTGTTSA
SRLMLDFDFDGRHAALELRTNGQMNPLTSGLLTHFRCPGSVG
 
Nucleotide Sequence: 3909 bp     [Download]
>gi|53721039|ref|NC_006351.1|:123821-127729 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGTCTTACCTGAAACGCTTCTTGAGATTCGTCTTTTCGTGGCAGATGCTCGCGTGCATCGCGGTGCTGC
TTGTTTGCGCCGCCGTATGGTTCGTCGGCCCCCTGCTCGCGTTCGACGAGTTGCGGCCGCTCGCGGGCGT
CGTCGTGCGGGTCGCCGTCATCGTCCTTCTCGTGGCGCTCCTTGCGTTCTGGCTGTTGCGCTGGCCGCTC
AGCCCGATCGGCGTCGCCGCACTGTGTCTGCTGATCTGGCACGCGGGGCCGCTCTTCGCGTTCGGCGATC
ACCGCCCGTTCGGGCCCGCGTGGGTCCGCGTGCTGATCGTCGCCGCGATGCTCTTCTGCTACGCCGTGTA
TGGTCTCTATCGCCTGTGGCGGGCGGTTCGGACGAACGACGCATTGCTCAAGCGCATTCTCGAGCCGTCG
GCGGGCAAGCCGGACGCGGCGGCCCAGGCGAACATCCGTGCGGTGAGCGTGGCGGTGTCGAAGGCGATCG
GTCAACTGAAGCGCTTGCGCGGCGGTGCGTTCGGCTGGCGGCGCTTGCTCGAAAGCGGGCGCTACCTGTA
TGAACTGCCGTGGTACATGGTGGTCGGCGCGCCTGGTGCGGGCAAGAGCGCGGCGATCGCGCGTTCCGGC
CTGAAGTTTCCGCTCGCGGATCAGATGGAGGCATCGTCCGAGCGCGCGCGGGGCGGCACGGCCAATTGCG
AATGGTGGTTCGCCAACGAGGCCGTGTTGATCGACACGGCGGGCCGTTACGTGCGGCACGAGGTGCCCGG
CGACGAAGAGGCGACAGTTGCCAACGGGGCGGAGTGGAAGGGCTTTCTCGGTCTGCTTCGCAAACATCGG
CCGCGCGCGCCGGTCAATGGCGTGGTCCTGTCGGTCAGCGTCGAGGAGCTCGTCGGGCGCACGCCGGCCG
AGCGCACCGCGCACGCAGCCACGCTGCGCGCCCGCCTGGGCGAGTTGCATCAGGAACTGGGCATTCATTT
CCCGGTATACGTGATCGTCACGAAACTCGATTTGCTGCCCGGCTTTCCGGAGTATTTCCAGTCGTTGACG
GCCGAAGGGCGGACGCAGATCTGGGGATTCACGCTGCCCTACGACGCGGAGAACAGGCGAAGCGCGGTCG
GCGCGCTGCGCGAGCATTGCGCCGACGAGCTGAAGCGGCTGGAGATGCGTATCGACGCGGGGCTGAACAA
CCGTCTGCTCGAAGAGTACGAAAACGATCGCCGCAAGCGGCTGTATGCGTTGCCGCAGGAGTTCCGGAGC
CTGTCGGCCGCGCTGTCGGACATGCTCGCCCTCGTGTTTCTCGATTCACGCTACGACGACGCCCAGTTGC
AGAACACGCTGCGCGGCGTCTACTTCACGAGCGCCGAGCAGACGGATCAGGTATTGGCCGCGGATCGCGA
AACCATCCTGCAGCGCTTGAAGCGCCAGCTCGGCAGAATGCTCGGCGGCGATGCCGGCGCGCAGACGCGT
GACAGCGGCGCGGTGTCGGGCAGCCGCGGCTACTTCCTGCGCGATGTGTTCCAGCATGTGATCGTGCCGG
AGGCGCATCTGGTTCGGCCGAACGTCAGGTGGGAGGTGCGTTTTCGCCTGATGCGCTGGGCCGGGCATCT
GCTCGCCGTCGCATTGCTGGTCTGGCTGGCGAGCGCGCTGACGGTGAGCTTCGACAACAATCGCGGCTAC
CTGGACGCGATCTCGGAAAAGACAGCCGCGCTCGCCGCACGAGTCAACGCGTACAACAAGGCGCCGAAGC
CGGCGCAGATCGGGGGTGTACTGGATGGCGCGCGCGATCTTCCTCAGCATGGCAATCTCGATCTCGACGC
GCCCGGCGCGAGCTTCCGCTACGGCCTGTATGTCGCACCCGGCATCGTCGACGCGTCCGACGCGACTTAT
CGGAGCCTGCTGCGCCGGAGCCTTCTGCCGCAGATCGTGCGGCGCGTCGAAGATGCACTGAGCGCGCAAA
TCGATGCGAAGCATGCGGACGAGGTCTATCGCACGCTGACGGTCTACTTGATGCTCGACGACGCCGCGCG
CCATGACGCGAAGGCGGTGAAAGACTGGGTCATGCGCGACTGGGAGCGCTCGGATAGCGCGGCCGAGATG
GGGGGGCGCAATTTGATGGCGCGGCACCTGGACGCGCTGTTCGTCGATGCTCGGCCTTTCGAGCCGAGCG
GGCACCGGAACGCCGCACTCGTTCAGCGCGCCCGGCTTTTCCTCAACGCGAACCCGGCCCCGAGGCGGCT
GTACGAGCGTGCGATGGCCGCGATCGAGAAGGAGGCGCCGGAGAACTTCACGCTCGCGCGTGCGGTCGGG
CTTCAGGGCGCGGGCATCTTTCGGCTCGCCGACGGCTCGCGGTTTCAACGCGGGATGCCCGGCTTGTATA
CGTACGATGGCTACCACCAGGTATTCAGCGCCCGGTTGCCCGAATTTCTCGCCCGTGCGCAAAGCGACGA
CGCATGGGTGATGGGGAACGCCGGCCCCGCCGCGCGATGGGGCGACGCGATTCGGAACACGCAGGCCGTT
GCGGGTCGGTCTTCGCTTGCCGACGACATTCGTCGCCAGTACCTGACGGATTACGGCAACTATTGGCAAC
AGTATCTGGCGGACATTCGGCCCGCGTCGTCCGGAGAGGACGGCGCGGGCGGCACGCTCGCATTCGATCT
CGCGACGCTGCGCGCGCTCGCCGCCCCCGATTCACCGCTCGTGAGACTGGCGCGCGCCGTCGTTCGCGAA
ACATCGCTGTCGGTCGTCGACGCACGGGAAGACGCGTCGTTGACCGACGCCGCGCTTTCGTCGCTCGGGC
GACGATCCGGCGCGGCGAAGGAGGTTGCCGACGGCGCGCAGAAACTGGCGGCGCGGCGGCCGGAGCAGCG
CCTCGAGAAGGAGCTGGTGGACAACCGCTTCGCGGCGCTGCGCGAGGTGGTGACGGGGCAGGCCGACACG
GGAAGCGGGCCGGCGATGACGGACGTGCCGGTCGCGGCGGGGGGCCGGGCGCTGCAGCTCGACGCGATCC
TCACGCTGATCAACGAACAGTACACGCGCCTCGTCGTTGCCGACAACGCGCTCTCCTCGCAGAGCATGCC
GCCCGCGCTGGACATCGGCACCACCTTGCAAATGGAGGCGGAGAAACTGCCCGCGCCGCTGCGCACGGTG
CTGGGCGGCATCGCGACGCAAGCCGCCGACAAAGTCGGGCGCGAAGTGGGTTCGCTGCTCGCGATGCAGG
TGGACTCGAGTGTCGGCAACGCGTGTCGCGCCGCCGTCGACGGCAAGTATCCGTTCGCGCGCAGCGCGCA
GGAAGTCGACATCGAGGATTTCAACCGCCTCTTCGCCGCGGGCGGCCTGTTCGACGCGTTTTTTCAGAAG
GCGCTCGCGCCGCATGTCGACACCCATTCGAAGCCGTGGCGTTACAAGGCGTTGAATCCCGGCATGCCGC
CGATCCGGGGGCCGAGCCTCGAGCCGTTCGAGCGCGCCGCCGCGATTCGCGACGTGTTCTTTCGTGAACC
GGGCGCAAAGCGGATGGCGTGGAGGATGGATGCGAAGGTGGCGTCGATCGACCCTGAGATCACCGAGCTC
ATCGTCGACGTCGACGGCCAGTCGCAGCGCTATGTCCACGGCCCCGTGCTGCCGTTCTCCGTGAACTGGC
CCGGGCCGCGCGGCGGCGCGATCGCCGAGATCACCGCGAAGCCGCGGATTCGTCCCGATACGTCGACGAT
CGCGACGACGGGGCCCTGGGCGCTGTTTCGGCTGATCGAGCGCGGGCGATTGACGGGCACCACGTCGGCG
AGCCGGTTGATGCTGGATTTCGATTTCGACGGTCGGCACGCGGCCCTGGAGCTCAGGACGAACGGCCAGA
TGAATCCGTTGACGAGCGGCTTGCTGACGCATTTTCGCTGTCCGGGGAGCGTCGGTTGA
 Primer design