SecReT6
Protein ID: 53721143
SecReT6 ID72
T6SS typei3
Gene symbol-
Locus tagBPSS0105
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]128553..131252 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ63P41
KEGG IDbps:BPSS0105
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.50E-78, Aligned region: 52..379
Phage_base_V [PF04717], Evalue: 8.40E-25, Aligned region: 419..512
Gp5_C [PF06715], Evalue: 0.0036, Aligned region: 563..583
Gp5_C [PF06715], Evalue: 0.0036, Aligned region: 596..612
Gp5_C [PF06715], Evalue: 0.0036, Aligned region: 604..625
Gp5_C [PF06715], Evalue: 0.0036, Aligned region: 624..641
Gp5_C [PF06715], Evalue: 0.0036, Aligned region: 629..648
Protein Sequence: 899 a.a.     [Download]
>gi|53721143|ref|YP_110128.1| unnamed protein product [Burkholderia pseudomallei K96243]
MFLGKWKREDCMPNHFSNGRTNQSRTVVIRSGAMPRLLGQPALEFLSLRGEEHLGKLYTYELLLRTPDDF
HVPLATSANLDLKAMIGTEMTVCIQLDGIGTGAQGGVGAGAREISGLVVKAGFLRCEGRYNVYRIELRPW
LWLATLTSDYKIFQDKSVVEIIDTVLHDYPYPVEKRLDIDKYSVAGESARNEPRAFQVQYGETDFDFVQR
LMEEWGIYWFFEHSDNKHRLVLCDHIGGHRKAPSEAYHEIAHHPEGGKIDIEYINYFSTDEALRPGRVVI
DDFDFTRPLASLVTSNHQPRETNWGEGELFEWPGDYTDSKHGDLISRVRMEERRATGSRAYGRGNVRGLA
CGHTFVLSKHKHDGANREYLVIESALMLTEVADETGSGYRYECDNELVVQPSNEVFRMPRETPKPTTSGP
QSAIVVGPPGHEVWTDEFGRVKIRFLWDRYARNDATDSCWVRVSQAWAGVNFGGIYIPRIGQEVIVGFMN
GDPDRPLILGSLYNTITPPPWDLPGDATKSGFKSKSITGGRENYNGIRFEDKLGAEEFHMQAEKDMNRLT
KNDESHTVGANFSIGVGLTHTRAVGAMFSSIVGGAASYAVGGAESTMIGGAYALNVGGAHAVAVGGASSV
SVGGAYARNVGGAYALTVGGVLSIVCGASSITMTACGSIKLVGKNIRIIGSDEVVVQGAPLQLNPGDSDC
GGGGGGGGGGGAIPPIPLPSFFLDITKPILPPPPPPPTEVPPDPTPTPTPTPTPTPTPTPTPTPTPTPTP
TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPMPTPTPTPTPTPTPTPTP
TPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTSSEI
 
Nucleotide Sequence: 2700 bp     [Download]
>gi|53721039|ref|NC_006351.1|:128553-131252 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
TTGTTTTTAGGTAAGTGGAAGCGAGAAGACTGCATGCCAAACCATTTTTCGAACGGACGGACGAATCAAA
GCCGCACGGTAGTGATCCGCAGCGGTGCGATGCCGCGGCTGCTCGGTCAGCCCGCGCTCGAGTTCCTGTC
GCTGCGCGGTGAAGAGCACCTCGGAAAACTCTACACGTACGAATTGCTCCTGCGCACGCCGGACGATTTT
CATGTGCCGTTGGCAACGAGCGCGAATCTCGACCTGAAGGCGATGATCGGCACGGAGATGACGGTCTGCA
TTCAGCTCGACGGAATCGGGACGGGCGCGCAAGGCGGCGTTGGCGCGGGTGCGCGCGAAATCAGCGGGCT
CGTGGTCAAGGCGGGCTTCCTGCGCTGCGAGGGGCGCTACAACGTCTATCGCATCGAGCTGCGCCCCTGG
CTGTGGCTCGCGACTTTGACGAGCGACTACAAGATTTTTCAGGACAAGAGCGTCGTCGAAATCATCGATA
CGGTCTTGCACGATTACCCTTACCCGGTCGAGAAGCGGCTCGACATCGACAAGTATTCGGTGGCGGGCGA
GAGCGCTCGAAACGAGCCGCGCGCGTTCCAGGTGCAATATGGCGAAACCGACTTCGACTTCGTTCAGCGT
TTGATGGAGGAGTGGGGGATCTACTGGTTCTTCGAGCATTCGGACAACAAGCATCGCCTGGTCTTGTGCG
ATCACATCGGCGGACATCGCAAGGCGCCGAGCGAGGCCTATCACGAGATCGCGCATCACCCGGAAGGCGG
GAAGATCGACATCGAGTACATCAACTATTTCTCGACGGACGAAGCGCTGCGGCCCGGCCGCGTCGTGATA
GACGATTTCGACTTCACGCGTCCGCTCGCGAGCCTCGTCACGTCCAATCACCAGCCGCGGGAGACGAACT
GGGGGGAGGGCGAGCTGTTCGAATGGCCGGGCGACTATACCGATAGCAAGCATGGCGATCTCATCAGCCG
CGTGCGCATGGAAGAGCGCCGCGCGACCGGGTCGCGCGCATACGGTCGGGGCAACGTGCGCGGCCTCGCC
TGCGGTCATACGTTCGTGCTGTCGAAGCACAAGCACGACGGCGCGAACCGCGAGTACCTCGTCATCGAAT
CGGCGTTGATGCTGACCGAAGTCGCGGACGAAACGGGCAGCGGCTACCGCTACGAATGCGATAACGAACT
GGTCGTGCAGCCGTCGAACGAGGTGTTTCGAATGCCGCGCGAAACGCCCAAGCCGACGACGAGCGGGCCA
CAGTCCGCGATCGTGGTCGGGCCGCCGGGCCACGAGGTATGGACCGACGAATTCGGCCGCGTGAAGATCC
GTTTTCTGTGGGATCGCTACGCACGCAATGACGCAACGGATTCCTGCTGGGTACGCGTGAGCCAGGCGTG
GGCCGGCGTGAACTTCGGCGGCATCTACATTCCGCGGATCGGACAGGAAGTGATCGTCGGATTCATGAAC
GGCGATCCGGACCGTCCGCTGATTCTCGGCAGCCTCTACAACACCATTACGCCGCCGCCTTGGGATCTGC
CCGGCGACGCGACGAAGAGCGGATTCAAGAGCAAGTCGATCACGGGCGGGCGCGAGAACTATAACGGCAT
CCGCTTCGAGGACAAGCTGGGAGCCGAGGAATTTCACATGCAGGCGGAAAAGGACATGAACCGCCTGACG
AAGAACGACGAGTCGCATACGGTCGGCGCGAATTTTTCGATCGGCGTCGGGCTTACCCATACGCGCGCGG
TGGGCGCCATGTTCAGCAGCATCGTCGGCGGAGCCGCCAGCTATGCGGTGGGGGGCGCGGAATCGACGAT
GATCGGCGGCGCGTATGCGTTGAACGTCGGCGGCGCGCACGCGGTTGCGGTGGGCGGCGCGTCGTCCGTT
TCCGTTGGCGGCGCCTACGCGCGCAACGTGGGCGGCGCGTATGCGCTGACAGTCGGCGGCGTGCTGTCGA
TCGTCTGCGGTGCGTCTTCGATCACCATGACGGCTTGCGGCTCGATCAAGCTCGTCGGCAAGAATATTCG
CATCATCGGCAGCGACGAAGTCGTCGTGCAAGGCGCGCCCCTGCAGCTGAATCCGGGCGATTCGGATTGC
GGCGGAGGGGGAGGCGGCGGCGGCGGCGGCGGCGCGATTCCGCCGATTCCGTTGCCGTCGTTCTTCCTCG
ATATCACGAAGCCGATTCTTCCGCCGCCGCCGCCGCCACCGACGGAGGTGCCACCGGATCCGACGCCGAC
GCCAACGCCGACGCCGACGCCCACGCCCACGCCGACGCCCACGCCGACGCCGACGCCGACGCCGACGCCG
ACGCCCACGCCGACGCCCACGCCGACGCCGACGCCGACGCCGACGCCCACGCCGACGCCCACGCCGACGC
CCACGCCAACGCCAACGCCAACGCCAACGCCAACGCCAACGCCAACGCCAACGCCAACGCCAACGCCGAC
GCCGACGCCGACGCCAATGCCGACGCCAACGCCAACGCCGACGCCGACGCCCACGCCTACGCCCACGCCG
ACGCCGACGCCGACGCCGACGCCAACGCCAACGCCAACGCCAACGCCAACGCCAACGCCGACGCCGACGC
CGACGCCCACGCCAACGCCGACGCCAACGCCAACGCCGACGCCCACGCCGACGCCGACGCCAACACCAAC
ACCAACACCAACACCAACTCCGACTAGTTCCGAGATTTAA
 Primer design