SecReT6
Protein ID: 53721146
SecReT6 ID72
T6SS typei3
Gene symbol-
Locus tagBPSS0110
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]137428..138498 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ63P38
KEGG IDbps:BPSS0110
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 8.10E-22, Aligned region: 61..120
ImpA-rel_N [PF06812], Evalue: 8.10E-22, Aligned region: 184..193
Protein Sequence: 356 a.a.     [Download]
>gi|53721146|ref|YP_110131.1| unnamed protein product [Burkholderia pseudomallei K96243]
MNATPSAAALRYADLLEPVSPDAPCGPDLEYDPAFVMLQSAIAPRKDAQYGEFVEAPQPANWAEAERDCL
ALLLRTKDIRLVVILMRCRIRQSGAEGLRDGLTLLNELLARYGEALHPVPFFEGERDPVVYANAIATLAD
PDATLADIREIPLPKASGLQLQLRDIEKALAVTRVKDALAPESASRLLKEWWNRRDKTIAALAQAQRIVA
DLIASTRESLGDDAPDLSGIAKLLHPFAQAQLESPYSANAAQPQGDAKPATGDAAHARAADTSAQAGDTD
TQAPAAMPIAPAQPPMDRWGALAAIQATRLWFEQNEPSSPVIVLLRQSERMVGKRFSEIANAIPAELLAQ
WDAIDV
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|53721039|ref|NC_006351.1|:c138498-137428 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGAATGCCACCCCATCCGCCGCCGCGCTGCGCTATGCGGATCTTCTCGAGCCCGTCTCGCCGGACGCAC
CCTGCGGGCCGGACCTCGAATACGATCCGGCGTTCGTGATGCTGCAATCCGCGATCGCGCCGAGGAAAGA
TGCGCAATATGGCGAGTTCGTCGAAGCGCCTCAGCCCGCGAACTGGGCGGAGGCCGAACGCGATTGCCTC
GCGCTGCTGCTGCGCACGAAAGACATCCGGCTCGTCGTGATCCTGATGCGATGCCGAATCCGCCAGAGCG
GCGCGGAGGGCCTGCGCGACGGCCTCACGCTGCTCAACGAGTTGCTCGCACGCTACGGTGAGGCACTGCA
CCCCGTACCGTTCTTCGAAGGCGAACGCGATCCCGTGGTCTATGCGAATGCGATCGCCACGCTGGCGGAC
CCCGATGCGACGCTCGCGGATATTCGGGAAATCCCGTTGCCCAAGGCGAGCGGCCTGCAATTGCAGTTGC
GCGACATCGAAAAGGCGCTCGCGGTGACGCGCGTGAAAGACGCACTCGCGCCCGAATCGGCCAGCCGGCT
GCTGAAGGAATGGTGGAATCGGCGCGACAAGACGATCGCGGCGCTCGCGCAAGCCCAGCGCATCGTGGCC
GATCTGATCGCGTCGACCCGCGAGTCGCTCGGCGACGACGCGCCCGACCTGTCCGGCATCGCGAAACTGC
TGCATCCGTTTGCGCAAGCGCAACTGGAATCGCCGTATTCGGCAAACGCCGCTCAACCGCAAGGCGACGC
GAAGCCGGCGACCGGCGACGCCGCGCATGCGCGCGCCGCCGATACGTCCGCCCAGGCAGGCGATACCGAC
ACGCAAGCGCCCGCTGCGATGCCGATCGCGCCTGCCCAACCGCCGATGGATCGCTGGGGCGCGCTGGCGG
CCATTCAGGCGACGCGCCTTTGGTTCGAGCAGAACGAGCCGAGCAGCCCGGTGATCGTGCTGCTGCGCCA
GTCGGAGCGGATGGTCGGCAAGCGCTTTTCGGAAATCGCCAATGCGATTCCCGCCGAACTGCTCGCGCAA
TGGGATGCGATCGACGTCTAG
 Primer design