SecReT6
Protein ID: 53721147
SecReT6 ID72
T6SS typei3
Gene symbol-
Locus tagBPSS0111
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]138517..139566 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ63P37
KEGG IDbps:BPSS0111
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.60E-98, Aligned region: 29..330
Protein Sequence: 349 a.a.     [Download]
>gi|53721147|ref|YP_110132.1| unnamed protein product [Burkholderia pseudomallei K96243]
MTAHPPAARPIDAHSPLHPDALRAWFDPQAPWRAGFLSLLRAIAARDTRVPLPGTACLPKEEAFRIGQRP
SMAFAPREIASLDVQRGRLDIQLFGLGLWGPQGPLPLHMTELAYNRAESYQDHAIAHFSNLFHHRALALF
YRAWASSQATVSLDRAEHETFSFYIGSLMGTDPEEAARTHPPTHARYAACAHLVREARNPDGVAATLSHY
FGVPIAVDEYVFHWIRIAPPERCLLGARAASTVMGEGALLGDMVADCQHKFRLVIGPLDLDQYLRLTPHG
NDLPTLVDWVRAFVGHEYDWEIKLLVKPRAAPPARADTTHRLGYSTWLGESRDDRPVVGMVFEPEKYCS
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|53721039|ref|NC_006351.1|:c139566-138517 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGACGGCGCATCCGCCCGCCGCCCGGCCCATCGACGCCCACTCGCCCCTGCATCCGGACGCACTGCGGG
CATGGTTCGATCCGCAAGCGCCGTGGCGCGCCGGCTTTCTGAGCCTGTTGCGCGCAATCGCCGCACGCGA
CACGCGCGTGCCCTTGCCCGGAACGGCGTGTCTGCCGAAGGAAGAGGCGTTTCGCATCGGACAACGGCCG
TCGATGGCCTTCGCGCCGCGCGAGATCGCATCGCTCGACGTGCAGCGCGGGCGTCTCGACATTCAGCTGT
TCGGCCTCGGCCTATGGGGGCCGCAGGGGCCGTTGCCGCTTCACATGACCGAGCTCGCGTACAACCGCGC
CGAGAGCTATCAGGATCATGCGATCGCGCATTTCTCCAATCTCTTTCACCATCGTGCGCTCGCGTTGTTC
TATCGTGCGTGGGCGTCGTCACAGGCGACCGTATCGCTCGATCGCGCCGAGCACGAAACGTTCTCGTTCT
ATATCGGCAGCCTGATGGGCACCGATCCCGAAGAAGCCGCGCGTACGCACCCGCCCACGCACGCGCGGTA
CGCCGCATGCGCGCATCTCGTGCGCGAGGCGCGCAATCCGGACGGCGTGGCCGCCACGCTGTCGCATTAC
TTCGGCGTGCCGATCGCCGTCGACGAATACGTCTTCCACTGGATCCGGATTGCGCCGCCGGAGCGTTGCC
TGCTCGGCGCGCGCGCCGCATCGACCGTCATGGGCGAGGGCGCGCTGCTCGGCGACATGGTTGCCGATTG
CCAGCACAAGTTCCGGCTCGTCATCGGCCCGCTCGATCTCGACCAATATCTTCGCCTGACGCCGCACGGC
AACGATCTGCCGACCCTGGTCGATTGGGTGCGCGCCTTCGTCGGTCACGAATACGACTGGGAGATCAAGC
TGCTCGTCAAGCCACGCGCCGCGCCGCCCGCCCGCGCGGATACCACGCACCGCCTCGGCTATTCGACCTG
GCTCGGCGAATCGAGGGACGACAGGCCGGTCGTCGGCATGGTGTTCGAGCCGGAAAAATACTGTTCCTGA
 Primer design