SecReT6
Protein ID: 53721148
SecReT6 ID72
T6SS typei3
Gene symbol-
Locus tagBPSS0112
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]139563..141443 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ63P36
KEGG IDbps:BPSS0112
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.90E-211, Aligned region: 5..624
Protein Sequence: 626 a.a.     [Download]
>gi|53721148|ref|YP_110133.1| unnamed protein product [Burkholderia pseudomallei K96243]
MDPQFLDHYNRELTYMRELSAEFAAQHPKIARRLGMQGIEVADPYVERLIEAFCFMSARTQLKLEAEFPR
FTQRLLEVAYPNYVAPTPSMAVARLRPSLREGDFSKGFKVPRHSMLRSSIPPGEQTACEFRTGQDITLWP
IEIAGATLTAVPPDLPDLQRSLLPHTKLRGALRLRVRTVGEIRFSQITGLDRLSLYIGGDERIASHLFEL
IHASSVASVVRAPGAARGEGAVVAKNAVDFEGLSPDQSLLPLVWNTFHGHNLLHEYFTCRQRFYFFALTQ
LNAGLSRIDGKEAEIVLLLDRLPDELVTHVEAARFLLFCAPIVNLFPKRTDRVEINRAQTAFHLIPDRTR
PLDYEVFSVSRVFGQKAETSTEVTFNPLYQTLHSDIGNYGRYFSILREPRTTSTNARKYGTRTPYVGTEV
YVSLVDQAEAPYADDIRYLSVDAWVTNRDLPRLIPRNGVNDLTMQDSVPIEGVSLVHPPSAPREPYATGE
TAWRLIRQLSFNYMPLAELDHRDGGQALRNMLRLFVGTSEREQATQIDSLVGARTEPVVRRLPGHGLLVY
GRGVRCELTVDESGFSGLSPYLFGLVLEQYLTRHVSINVFTETELRSMQRGLVTRWKPRMGGRGAV
 
Nucleotide Sequence: 1881 bp     [Download]
>gi|53721039|ref|NC_006351.1|:c141443-139563 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGGACCCGCAGTTTCTCGATCACTACAACCGCGAATTGACCTACATGCGGGAGTTGTCCGCGGAATTCG
CGGCGCAACACCCGAAGATCGCGCGCCGACTCGGCATGCAAGGCATCGAAGTGGCGGACCCGTACGTAGA
ACGGCTCATCGAGGCGTTCTGCTTCATGTCCGCGCGCACGCAACTCAAGCTCGAGGCCGAGTTCCCCCGC
TTCACGCAACGCCTGCTCGAAGTCGCCTATCCGAATTACGTCGCGCCGACGCCGTCGATGGCCGTCGCGC
GCCTGCGTCCAAGCCTGCGGGAAGGCGACTTCAGCAAGGGGTTCAAGGTTCCGCGTCACAGCATGCTGCG
CTCGTCGATCCCGCCCGGCGAGCAGACCGCATGCGAATTCCGCACCGGCCAGGACATCACGCTCTGGCCC
ATCGAGATCGCCGGCGCGACGCTGACCGCCGTGCCGCCCGATCTTCCGGATCTTCAGCGCAGCCTGCTGC
CGCACACGAAGCTGCGCGGCGCACTCCGGCTGCGCGTGCGCACCGTCGGCGAAATCAGGTTTTCGCAAAT
TACCGGGCTCGATCGCCTCTCGCTGTATATCGGCGGCGACGAACGCATCGCCTCCCATCTTTTCGAGCTG
ATTCACGCGAGCAGCGTCGCGTCGGTCGTGCGCGCGCCGGGCGCCGCGCGCGGCGAAGGCGCCGTCGTCG
CGAAGAATGCGGTCGACTTCGAAGGCCTGTCGCCCGATCAAAGCCTGTTGCCGCTCGTCTGGAATACGTT
CCACGGGCACAATCTGCTGCACGAATACTTCACCTGCCGTCAGCGCTTCTATTTCTTCGCGCTCACGCAA
TTGAACGCCGGCTTGTCGCGCATCGACGGAAAGGAAGCCGAAATCGTGCTGTTGCTCGACCGCTTGCCCG
ACGAGCTCGTCACGCACGTCGAGGCCGCGCGCTTTCTGCTGTTTTGCGCCCCCATCGTCAATCTGTTCCC
GAAGCGGACCGACCGGGTGGAAATCAATCGCGCCCAAACGGCTTTCCACCTGATACCGGACCGCACCCGC
CCGCTCGATTACGAAGTGTTCTCGGTGTCGCGCGTGTTCGGGCAAAAAGCCGAGACGTCGACGGAAGTCA
CGTTCAATCCGCTCTATCAGACGCTGCATAGCGACATCGGCAATTACGGCCGGTATTTCTCGATCCTGCG
CGAACCCAGAACGACATCGACCAACGCGCGTAAATATGGAACGCGCACGCCATACGTCGGAACGGAAGTC
TACGTGTCGCTCGTCGACCAGGCCGAAGCGCCGTACGCCGACGACATTCGTTACCTGTCCGTCGACGCAT
GGGTCACCAACCGCGATCTGCCCCGACTGATCCCGCGCAACGGCGTCAACGATCTGACGATGCAAGACTC
CGTGCCGATCGAGGGCGTGAGCCTCGTCCATCCGCCGAGCGCGCCGCGCGAGCCGTACGCGACCGGCGAA
ACCGCGTGGCGGCTGATTCGCCAGCTCAGCTTCAACTACATGCCGCTTGCCGAGCTCGACCACCGCGACG
GCGGGCAAGCACTGCGCAACATGCTGCGCCTCTTCGTCGGCACGAGCGAGCGCGAACAGGCCACGCAGAT
CGACAGCCTGGTCGGCGCGCGCACGGAGCCTGTCGTCCGCCGTCTGCCCGGCCACGGATTACTGGTTTAC
GGGCGCGGCGTCCGGTGCGAGCTGACCGTCGACGAAAGCGGCTTCTCCGGGTTGAGTCCATACCTGTTCG
GTCTCGTGCTCGAGCAATACCTCACGCGCCACGTCTCGATCAATGTGTTCACCGAGACGGAGCTTCGCTC
GATGCAACGCGGCCTCGTCACGCGCTGGAAACCGCGCATGGGCGGAAGGGGCGCGGTATGA
 Primer design