SecReT6
Protein ID: 53721150
SecReT6 ID72
T6SS typei3
Gene symbol-
Locus tagBPSS0114
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]141950..142804 [-]
Producthypothetical protein
NoteTagJ
UniProt IDQ63P34
KEGG IDbps:BPSS0114
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 9.50E-44, Aligned region: 155..275
Protein Sequence: 284 a.a.     [Download]
>gi|53721150|ref|YP_110135.1| unnamed protein product [Burkholderia pseudomallei K96243]
MTNRSESPQPSDPRDAMLRDALRAQSFEEIKARTAEAVRKRPSDTRERWLLFQLLCIDGAWERALKQLQT
WAGLEPQGEARAQLHRGLIRCEMFRADVFAGKRTPGFIDAQPAWVDTLLQANAKLGAGDVAAADTLREAA
FHCAPVTRGESAEMGSFAWLTDSDTRLGPIFEIAVAGGYRWIPFEQLKSITFTPAGTLTDLVWRPVTALM
LDATVLRGYAPTRYSGSENGATAIRLASETTWRDIGTTNVVALGQRTWTTDQGDWGMLQIGGCRFTGESD
DAAS
 
Nucleotide Sequence: 855 bp     [Download]
>gi|53721039|ref|NC_006351.1|:c142804-141950 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGACGAATCGATCTGAATCTCCGCAACCCTCCGATCCGCGTGACGCCATGCTGCGCGACGCGCTGCGCG
CCCAGTCTTTCGAGGAAATCAAGGCGCGCACGGCCGAGGCGGTCAGAAAGCGGCCATCCGACACGCGGGA
ACGCTGGCTACTGTTTCAGTTGCTTTGCATCGACGGCGCGTGGGAGCGCGCGCTCAAACAGCTGCAAACC
TGGGCCGGGCTCGAGCCGCAGGGCGAGGCGCGCGCGCAACTGCATCGCGGCCTGATCCGATGCGAAATGT
TCCGGGCCGACGTGTTTGCCGGCAAGCGAACGCCGGGGTTCATCGACGCGCAGCCCGCCTGGGTCGACAC
GCTCCTCCAAGCCAATGCGAAGCTCGGCGCCGGCGACGTCGCGGCGGCGGACACGCTGCGCGAAGCCGCG
TTCCACTGCGCCCCTGTCACCCGCGGGGAAAGCGCCGAAATGGGAAGCTTCGCATGGCTTACCGACAGCG
ACACCCGCCTCGGTCCGATCTTTGAAATAGCGGTTGCAGGCGGCTATCGATGGATTCCGTTCGAACAACT
GAAGTCCATCACGTTTACGCCCGCCGGCACGCTGACCGACCTGGTCTGGCGACCGGTCACGGCACTCATG
CTCGATGCCACGGTTCTCCGCGGCTATGCACCCACCCGCTATTCGGGATCGGAGAACGGCGCGACCGCGA
TCCGCTTGGCCAGCGAGACGACCTGGCGCGACATCGGCACCACCAACGTCGTGGCGCTCGGACAACGAAC
ATGGACCACCGATCAGGGCGACTGGGGCATGCTCCAGATCGGCGGATGCCGCTTCACGGGCGAAAGCGAC
GATGCGGCATCCTGA
 Primer design