SecReT6
Protein ID: 53721152
SecReT6 ID72
T6SS typei3
Gene symbol-
Locus tagBPSS0116
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]144273..146918 [+]
Productchaperone-related protein
NoteTssH
UniProt IDQ63P32
KEGG IDbps:BPSS0116
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 8.40E-39, Aligned region: 230..310
AAA_2 [PF07724], Evalue: 8.40E-39, Aligned region: 608..773
AAA [PF00004], Evalue: 8.20E-21, Aligned region: 232..363
AAA [PF00004], Evalue: 8.20E-21, Aligned region: 613..697
ClpB_D2-small [PF10431], Evalue: 1.20E-15, Aligned region: 440..457
ClpB_D2-small [PF10431], Evalue: 1.20E-15, Aligned region: 780..853
AAA_5 [PF07728], Evalue: 4.80E-15, Aligned region: 232..310
AAA_5 [PF07728], Evalue: 4.80E-15, Aligned region: 612..731
AAA_16 [PF13191], Evalue: 3.90E-10, Aligned region: 209..253
AAA_16 [PF13191], Evalue: 3.90E-10, Aligned region: 273..310
AAA_16 [PF13191], Evalue: 3.90E-10, Aligned region: 377..398
AAA_16 [PF13191], Evalue: 3.90E-10, Aligned region: 583..655
AAA_16 [PF13191], Evalue: 3.90E-10, Aligned region: 677..696
Sigma54_activat [PF00158], Evalue: 3.20E-09, Aligned region: 228..312
Sigma54_activat [PF00158], Evalue: 3.20E-09, Aligned region: 612..711
AAA_22 [PF13401], Evalue: 5.80E-08, Aligned region: 232..313
AAA_22 [PF13401], Evalue: 5.80E-08, Aligned region: 611..635
AAA_22 [PF13401], Evalue: 5.80E-08, Aligned region: 674..699
AAA_19 [PF13245], Evalue: 2.10E-07, Aligned region: 230..258
AAA_19 [PF13245], Evalue: 2.10E-07, Aligned region: 610..634
AAA_17 [PF13207], Evalue: 8.50E-06, Aligned region: 232..271
AAA_17 [PF13207], Evalue: 8.50E-06, Aligned region: 612..650
AAA_18 [PF13238], Evalue: 1.50E-05, Aligned region: 232..293
AAA_18 [PF13238], Evalue: 1.50E-05, Aligned region: 613..644
Zeta_toxin [PF06414], Evalue: 2.50E-05, Aligned region: 232..254
Zeta_toxin [PF06414], Evalue: 2.50E-05, Aligned region: 605..652
AAA_29 [PF13555], Evalue: 3.20E-05, Aligned region: 224..251
AAA_29 [PF13555], Evalue: 3.20E-05, Aligned region: 610..637
NACHT [PF05729], Evalue: 5.70E-05, Aligned region: 232..260
NACHT [PF05729], Evalue: 5.70E-05, Aligned region: 612..639
AAA_25 [PF13481], Evalue: 9.10E-05, Aligned region: 232..256
AAA_25 [PF13481], Evalue: 9.10E-05, Aligned region: 436..485
AAA_25 [PF13481], Evalue: 9.10E-05, Aligned region: 610..638
IstB_IS21 [PF01695], Evalue: 0.00014, Aligned region: 223..252
IstB_IS21 [PF01695], Evalue: 0.00014, Aligned region: 612..632
AAA_14 [PF13173], Evalue: 0.00025, Aligned region: 232..312
AAA_14 [PF13173], Evalue: 0.00025, Aligned region: 611..699
DEAD [PF00270], Evalue: 0.003, Aligned region: 220..245
DEAD [PF00270], Evalue: 0.003, Aligned region: 304..317
DEAD [PF00270], Evalue: 0.003, Aligned region: 376..401
DEAD [PF00270], Evalue: 0.003, Aligned region: 612..793
TIP49 [PF06068], Evalue: 0.003, Aligned region: 232..258
TIP49 [PF06068], Evalue: 0.003, Aligned region: 292..312
TIP49 [PF06068], Evalue: 0.003, Aligned region: 611..647
RNA_helicase [PF00910], Evalue: 0.0038, Aligned region: 233..253
RNA_helicase [PF00910], Evalue: 0.0038, Aligned region: 613..634
T2SE [PF00437], Evalue: 0.0062, Aligned region: 222..252
T2SE [PF00437], Evalue: 0.0062, Aligned region: 608..681
NTPase_1 [PF03266], Evalue: 0.0088, Aligned region: 232..254
NTPase_1 [PF03266], Evalue: 0.0088, Aligned region: 612..634
Hpr_kinase_C [PF07475], Evalue: 0.0093, Aligned region: 232..244
Hpr_kinase_C [PF07475], Evalue: 0.0093, Aligned region: 610..630
RuvB_N [PF05496], Evalue: 0.0094, Aligned region: 230..251
RuvB_N [PF05496], Evalue: 0.0094, Aligned region: 303..312
RuvB_N [PF05496], Evalue: 0.0094, Aligned region: 574..633
RuvB_N [PF05496], Evalue: 0.0094, Aligned region: 681..705
UPF0079 [PF02367], Evalue: 0.0098, Aligned region: 232..252
UPF0079 [PF02367], Evalue: 0.0098, Aligned region: 610..638
Protein Sequence: 881 a.a.     [Download]
>gi|53721152|ref|YP_110137.1| unnamed protein product [Burkholderia pseudomallei K96243]
MTVSRQALFGKLGYSLFRSIESATAFCKLRGNPYVELVHWLHQMLQAADGDMQRIARHCDIDLGELERDM
VRALGELPAGASSISDFSHHIETAIERAWVLATLDFGDRRIRGAWLLAALLKTPELRRVLLSISSAFGRI
RVDELDAMLPAWIDGSPEANETPYDDSDFGAAIPGEASSAMQQKGGGSPLEQFCLDLTARARAGQIDPVV
GRELEIRTMIDVLLRRRQNNPLLTGEAGVGKTAVVEGLARAIAAGDVPPKLADARLLSLDVGALLAGASM
KGEFEARLKGVLEAAAKATLPVILFVDEIHTLIGAGGQAGTGDAANLLKPALARGTLRTIGATTWAEYKR
HIEKDPALTRRFQVLQVPEPDEAAAIDMVRGLTRTFSRHHGVVVLDEAIRAAVKLSHRYIPSRQLPDKAI
SLLDTACARVALSQHAPPRELQDVRRRLEAARVRLELLDGEQRIGLGDEAALAQSRAEIAALEVEEQSID
ACWRQQIEAAQTLLSAREAAGDAAASAIDALRELEHALSNLQGDHAFVFPEVNEAIVAEIMSDWTGIPVG
RMVTDEVSAVRALPDTLAARVIGQRDALHQIGDRVQTARAGLTDPKKPLGVFLLAGPSGVGKTETALALA
EALYGGEQNLITINMSEYQEAHTVSGLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHPDVHEM
FFQVFDKGYMEDGDGRYIDFRNTTILLTSNAGSDLVSGLCMDEACAPDADGLCAALASELLKTFPAAFLG
RVTLVPYRPLAQETLSRIVRLHLDRVVTRMAENQGVALRYSDNVVDYVVNRCLVQETGARLLIGFIEQHV
LPLLAKLWLDSLASKHVLTRVDLDVADPAAAPTEAFALRAS
 
Nucleotide Sequence: 2646 bp     [Download]
>gi|53721039|ref|NC_006351.1|:144273-146918 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGACAGTTTCAAGACAGGCACTATTCGGCAAGCTCGGCTACTCGCTGTTTCGCAGCATCGAATCGGCGA
CGGCGTTCTGCAAGCTTCGCGGCAACCCTTACGTCGAGCTGGTGCATTGGCTGCATCAGATGCTTCAGGC
CGCTGACGGCGATATGCAGCGGATCGCTCGCCACTGCGACATCGACCTCGGCGAGCTGGAGCGCGACATG
GTGCGCGCGCTCGGCGAACTGCCGGCGGGCGCGAGCTCGATCAGCGATTTCTCGCACCACATCGAGACGG
CGATCGAGCGCGCGTGGGTGCTGGCGACACTGGATTTCGGCGATCGCCGGATTCGCGGCGCGTGGCTACT
GGCTGCGTTGCTGAAGACGCCGGAGCTCAGGCGCGTACTGCTGTCGATTTCGTCCGCGTTCGGCCGGATT
CGTGTCGACGAACTGGATGCGATGTTGCCGGCCTGGATCGACGGCTCGCCCGAGGCGAACGAGACGCCGT
ACGACGACAGCGACTTCGGCGCGGCCATACCGGGCGAGGCGTCGAGCGCGATGCAGCAAAAGGGCGGCGG
TTCACCGCTGGAGCAGTTCTGCCTCGATCTCACCGCGCGAGCGCGAGCGGGGCAGATCGATCCGGTCGTC
GGTCGTGAGCTGGAAATCCGCACGATGATCGACGTCCTGTTGCGCCGCCGCCAGAACAACCCGCTGCTGA
CGGGCGAGGCGGGCGTGGGCAAGACGGCCGTCGTCGAAGGGCTCGCGCGCGCGATCGCCGCCGGCGATGT
GCCGCCGAAGCTTGCCGATGCGCGCCTGCTGAGCCTCGATGTCGGCGCGCTGTTGGCCGGGGCGAGCATG
AAGGGCGAATTCGAGGCGCGCCTGAAAGGCGTGCTGGAGGCGGCGGCGAAAGCGACGCTGCCCGTCATTC
TGTTTGTCGACGAGATTCACACGCTGATCGGCGCGGGCGGCCAGGCGGGCACCGGAGATGCCGCGAACCT
GCTCAAGCCCGCGCTCGCGCGCGGCACGCTGCGAACGATCGGTGCGACGACGTGGGCGGAATACAAGCGG
CACATCGAAAAGGATCCGGCGCTCACACGCCGCTTCCAGGTGTTGCAGGTTCCCGAGCCCGACGAGGCGG
CCGCGATCGACATGGTTCGAGGGCTGACGCGAACCTTCTCGCGTCATCATGGCGTCGTCGTGCTGGACGA
GGCGATTCGCGCGGCGGTCAAGCTGTCGCATCGCTACATTCCATCCCGTCAGTTGCCGGACAAGGCGATC
AGCCTGCTCGATACGGCGTGCGCGCGCGTCGCGTTGTCGCAGCATGCGCCGCCGCGTGAGCTGCAGGACG
TCCGCAGAAGATTGGAGGCCGCGAGGGTGCGGCTCGAATTGCTCGACGGCGAGCAGCGCATCGGCCTTGG
CGACGAAGCCGCGCTCGCGCAGTCTCGCGCGGAAATCGCCGCGCTCGAGGTGGAGGAGCAATCGATCGAT
GCTTGCTGGCGGCAGCAGATCGAGGCCGCGCAGACGCTGCTCAGCGCGCGCGAGGCGGCGGGCGACGCTG
CGGCGAGCGCGATCGACGCGCTGCGCGAGCTGGAGCATGCGCTGTCGAACCTGCAAGGCGATCACGCGTT
CGTTTTCCCCGAGGTCAACGAAGCGATCGTCGCGGAGATCATGTCCGACTGGACCGGCATTCCGGTCGGC
AGAATGGTGACGGACGAAGTGTCCGCCGTGCGCGCCTTGCCGGACACGCTCGCCGCCCGCGTGATCGGTC
AACGCGATGCGTTGCATCAGATTGGCGATCGGGTGCAAACGGCGCGCGCCGGATTGACCGATCCGAAGAA
GCCGCTCGGCGTGTTCCTGCTCGCGGGGCCGTCGGGCGTCGGCAAGACGGAGACGGCATTGGCGCTTGCC
GAGGCGCTGTACGGCGGCGAGCAGAATCTCATCACGATCAACATGAGCGAATATCAGGAGGCGCATACGG
TATCGGGGCTGAAGGGCGCCCCGCCGGGTTACGTCGGATACGGCGAGGGCGGCGTGCTGACCGAGGCGGT
GCGCAGGCGTCCGTATTCCGTCGTGCTCCTCGACGAGATCGAGAAGGCGCATCCCGACGTCCACGAGATG
TTCTTCCAGGTATTCGACAAGGGCTACATGGAGGACGGCGACGGGCGCTATATCGATTTTCGCAACACGA
CGATTCTTCTCACCAGCAATGCAGGCTCCGACCTCGTGTCCGGACTGTGCATGGACGAGGCTTGCGCTCC
CGACGCGGACGGCCTTTGCGCCGCGCTCGCTTCCGAATTGCTCAAGACGTTTCCCGCGGCGTTTCTCGGG
CGCGTGACGCTGGTGCCCTATCGTCCGCTCGCGCAGGAAACGCTATCGCGCATCGTCCGGCTGCATCTGG
ACCGAGTGGTGACGCGAATGGCCGAGAATCAGGGTGTCGCCCTGCGTTATTCGGACAATGTCGTCGATTA
CGTCGTCAATCGCTGCCTCGTGCAGGAAACGGGGGCGCGCTTGCTGATCGGCTTCATCGAGCAGCATGTG
TTGCCGCTGCTCGCGAAGCTCTGGCTGGATTCGCTTGCGTCCAAGCACGTGCTGACACGCGTCGACCTCG
ACGTGGCCGATCCCGCCGCGGCCCCGACCGAAGCGTTCGCGCTGCGCGCTTCATGA
 Primer design