SecReT6
Protein ID: 53721203
SecReT6 ID73
T6SS typei3
Gene symbol-
Locus tagBPSS0167
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]221397..225473 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ63NY1
KEGG IDbps:BPSS0167
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 8.10E-97, Aligned region: 632..952
ImcF-related_N [PF14331], Evalue: 4.50E-93, Aligned region: 313..585
DUF1215 [PF06744], Evalue: 1.20E-35, Aligned region: 951..979
DUF1215 [PF06744], Evalue: 1.20E-35, Aligned region: 1060..1184
Protein Sequence: 1358 a.a.     [Download]
>gi|53721203|ref|YP_110188.1| unnamed protein product [Burkholderia pseudomallei K96243]
MNKFLSFLVSRSFIAFVALLAVALVIWFVGPFVAFGGLTPLAGAGMRVLAIALLLAGVLLWLAGRPTSIV
FVALLCVLIWHASPLLAFGGATPFAAEAVRAIAIALVLAAFALHLAFRLLQKARTDPDFLKSLLEFGGKQ
PESPAAGRLVAVNAAIAGAIARLKGMRSGARGLRRLLRGKRYLYELPWYVTLGSRACGKTSALLNAGLSF
PVAAQMPRAAAGLPDHGGSVDWWLTNDAVLIDTAGHYTRHGTSAHAAPLPPAGPAPHAQPFDAAADARRA
NGQPAGERHAVAMAAAAPSSAAFVDERQAQWRQTVDQAEWLGFLRTLRKHRPREPINGALLAVDVATLTS
ADDNARHAEAAALRARLADLRAQLGVRFPVYLIVTKTDQLPGFAEYFSALTTEGRAQTWGFTLPYDKETI
ADEGVHARCADELRALAARLAAGVNTRLQEEHDTQRRRRLAALPEEFLVLTRPLGELIDRVFADSRYDDT
QHHATLRGVYFTSAAQTGGEAAAETRTVARRLAAATGRAPAAAARAAQQETSQSFFLHDLLTKIVIPDAR
LVQPNLRWEYRSRTLSLAAHALALLLFAWVAIGLRVSMGNNDAYLDALARKTAALASRVDQLYKAPKPEA
VPDVLTQARSLSAYPGLDLSAPGSGWRFGLYTPPGIVAESSRTYDALEDTLLLPRIVTRIEAVLSQAIAD
RDPNAAYDALRVYLMLYDRARFDAAQVEAWVLDDWARTDSAAVFGGRASMIAHVEQLFRGERIVQSPLIR
NDALIRQARAFLDGSNATERLYERAKAAMNKEAPDEFTLLRAVGPQAGTVFTRASGAPLARGVPGLFTFD
GYRRVFDKRLAEFVRTAREDDAWVMGRAYLGDAQKKTAEIANALAGADDPLTDAIRRQYLIEYAQQWDAF
LGDIRTIGGTSLAFDLVVLRSFAAPDSPLERLARAAVHETTLAQPEASADRSFLQKASAQLSQQADKALG
VRAQERVERELVDNRFAGLREMVTGRADTQTDARPGAPAGKSGLDAVANLLNDYYTALTVSDDALANNSM
PPANDTAAKLKMAAQTMPAPFRSVLTGLAAQGSREVNRGIGQLLSRQLQATVGDVCRLAIEGNYPFAPDS
KRDVGIEDFTRVFAQGGVIDDFFAKTLAPFVDTSTRPWRYKTLPGATEPVEGPDLEPFQHAKAIREVFFG
APGQKQMAWKADIRIPELDPTITSLAIDVDGQTALYQHGPVAPFAVSWPGPRGGVHAEITASPRIRPDTS
AVSTDGPWALLRLLQKGRVSGTATPGRTRVTLDFDGRKAVLDLASTGSVANPLTSDVLKTFRCPGSMPMF
SLADTGAPPGLPPGSPAAPTSRVARDGR
 
Nucleotide Sequence: 4077 bp     [Download]
>gi|53721039|ref|NC_006351.1|:c225473-221397 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGAACAAGTTCCTGTCCTTTCTGGTGTCTCGATCGTTCATCGCGTTCGTCGCGCTGCTCGCCGTCGCGC
TCGTCATCTGGTTCGTCGGCCCGTTCGTCGCGTTCGGCGGGCTCACGCCGCTCGCGGGCGCGGGCATGCG
CGTCCTCGCGATCGCGCTGCTGCTGGCGGGCGTGCTGCTGTGGCTCGCGGGCCGGCCGACGAGCATCGTG
TTCGTCGCGCTGCTGTGCGTGCTGATCTGGCATGCGTCGCCGCTGCTCGCGTTCGGCGGCGCGACGCCGT
TCGCGGCGGAGGCGGTCCGGGCGATCGCGATCGCGCTCGTGCTCGCGGCGTTCGCGCTGCACCTTGCGTT
CCGGCTGCTGCAAAAGGCGCGCACCGATCCGGATTTTCTGAAGAGCCTGCTCGAATTCGGCGGCAAGCAG
CCCGAATCGCCCGCGGCCGGCCGCCTGGTGGCGGTCAACGCCGCGATCGCCGGCGCGATCGCGCGCCTGA
AAGGCATGCGCAGCGGCGCGCGCGGCCTGCGCCGCCTGTTGCGCGGCAAGCGCTATCTGTACGAACTGCC
GTGGTACGTCACGCTCGGCTCGCGGGCATGCGGCAAGACGAGCGCGCTCCTGAACGCCGGGCTCTCGTTT
CCGGTCGCGGCGCAAATGCCGCGCGCGGCAGCCGGGCTGCCGGATCACGGCGGCTCGGTCGACTGGTGGT
TGACCAACGATGCGGTGCTGATCGACACGGCCGGCCATTACACGCGTCACGGCACGTCGGCGCACGCGGC
GCCGCTGCCGCCCGCCGGGCCCGCGCCGCACGCCCAGCCCTTCGACGCGGCCGCCGACGCGCGCCGCGCG
AACGGTCAGCCGGCGGGCGAGCGGCACGCCGTCGCGATGGCCGCGGCGGCGCCGTCGAGCGCCGCGTTCG
TCGACGAGCGGCAGGCGCAATGGCGGCAGACCGTCGACCAGGCCGAATGGCTGGGCTTTCTGCGGACGCT
GCGCAAGCATCGGCCGCGCGAGCCGATCAACGGCGCGCTGCTCGCCGTCGACGTCGCCACGCTCACGAGC
GCCGACGACAATGCGCGCCATGCCGAGGCAGCCGCGCTGCGCGCGCGGCTCGCCGATCTGCGCGCGCAAC
TGGGCGTGCGCTTTCCCGTCTATCTGATCGTCACGAAGACGGACCAGTTGCCGGGCTTCGCCGAATACTT
CAGCGCGCTGACCACGGAGGGCCGCGCGCAGACGTGGGGGTTCACGCTGCCGTACGACAAGGAGACCATC
GCGGACGAAGGCGTCCACGCGCGCTGCGCCGACGAGCTGCGCGCGTTGGCCGCGCGGCTCGCCGCGGGCG
TGAACACCCGCCTGCAGGAAGAGCACGACACGCAGCGGCGCCGCCGGCTCGCCGCGCTGCCGGAGGAATT
TCTCGTGCTGACACGCCCGCTCGGCGAGCTGATCGATCGCGTCTTCGCCGATTCCCGCTACGACGACACG
CAGCATCACGCGACGCTGCGCGGCGTGTATTTCACGAGCGCCGCGCAGACGGGCGGCGAGGCCGCCGCCG
AAACGCGCACCGTCGCGCGACGCCTCGCCGCCGCGACGGGCCGCGCGCCGGCCGCGGCCGCGCGCGCGGC
GCAGCAGGAAACCAGCCAGAGCTTCTTCCTGCACGATCTGCTGACGAAGATCGTCATTCCGGACGCACGC
CTCGTCCAGCCGAACCTTCGCTGGGAGTATCGCTCGCGCACGCTGAGCCTCGCCGCTCACGCGCTCGCGC
TGCTGCTGTTCGCGTGGGTCGCGATCGGCCTGCGCGTCAGCATGGGCAACAACGATGCCTATCTCGACGC
GCTCGCGCGCAAGACGGCGGCGCTCGCCTCCCGGGTCGACCAGTTGTACAAGGCGCCGAAGCCCGAGGCC
GTGCCCGACGTGCTGACGCAAGCCCGCTCGCTGAGCGCGTACCCGGGCCTCGATCTGTCCGCGCCGGGCA
GCGGCTGGCGGTTCGGCCTGTACACGCCGCCCGGCATCGTCGCCGAAAGCAGCCGCACGTACGACGCGCT
CGAGGACACCCTGCTGCTGCCGCGGATCGTCACGCGCATCGAGGCGGTGCTGTCGCAGGCGATCGCCGAT
CGCGATCCGAATGCCGCGTACGACGCGCTGCGCGTCTATCTGATGCTGTACGACCGGGCCCGCTTCGATG
CCGCGCAGGTCGAGGCGTGGGTGCTCGACGACTGGGCGCGAACCGACAGCGCGGCGGTCTTCGGCGGCCG
CGCGTCGATGATCGCGCACGTCGAGCAACTGTTCCGCGGCGAGCGCATCGTGCAATCCCCGCTGATCCGC
AACGATGCGCTGATCCGCCAGGCGCGCGCGTTCCTGGACGGCAGCAACGCGACCGAGCGGCTCTACGAGC
GCGCGAAGGCGGCGATGAATAAAGAAGCGCCCGACGAGTTCACGCTGCTGCGGGCCGTCGGCCCGCAGGC
CGGCACGGTGTTCACGCGCGCGAGCGGCGCGCCGCTCGCGCGGGGCGTGCCGGGCCTCTTCACGTTCGAC
GGATACCGGCGCGTGTTCGACAAGCGGCTCGCCGAATTCGTGCGGACCGCGCGCGAAGACGATGCATGGG
TGATGGGCCGCGCGTATCTCGGCGACGCTCAAAAAAAAACGGCTGAGATCGCGAATGCGCTCGCGGGGGC
CGACGATCCGCTGACCGACGCGATCCGCCGGCAATATCTGATCGAATACGCGCAGCAATGGGACGCGTTT
CTCGGCGACATCCGCACGATCGGCGGCACGAGCCTCGCATTCGATCTCGTGGTGCTGCGCAGCTTCGCGG
CGCCGGATTCGCCGCTCGAGCGGCTCGCGCGCGCGGCGGTTCACGAGACGACGCTCGCGCAGCCCGAAGC
GAGCGCCGATCGCTCGTTCCTGCAAAAGGCGTCCGCCCAGTTGAGCCAGCAGGCGGACAAGGCGCTCGGC
GTGCGCGCGCAGGAGCGCGTCGAGCGCGAGCTCGTCGACAATCGCTTCGCGGGCCTGCGCGAAATGGTGA
CGGGCCGCGCGGACACGCAAACGGACGCGCGCCCGGGCGCGCCGGCCGGCAAGAGCGGGCTCGATGCGGT
CGCGAACCTGCTGAACGACTACTACACGGCGCTGACCGTCTCGGACGACGCGCTCGCGAACAACAGCATG
CCGCCCGCGAACGATACCGCGGCGAAACTGAAGATGGCCGCGCAGACGATGCCCGCGCCGTTTCGCTCGG
TGCTGACCGGGCTCGCCGCGCAGGGCTCGCGCGAAGTGAACCGCGGCATCGGCCAGTTGCTGTCGCGGCA
GTTGCAGGCGACGGTAGGCGACGTTTGCCGCCTCGCGATCGAGGGCAACTATCCGTTCGCGCCCGACAGC
AAGCGCGACGTCGGCATCGAGGACTTCACGCGCGTGTTCGCGCAAGGCGGCGTGATCGACGACTTCTTCG
CGAAGACGCTCGCGCCGTTCGTCGACACGTCGACGCGGCCTTGGCGCTACAAGACGCTGCCCGGCGCGAC
CGAACCGGTGGAGGGCCCCGATCTCGAACCGTTTCAGCACGCGAAGGCGATTCGCGAAGTGTTTTTCGGC
GCGCCCGGCCAGAAGCAGATGGCGTGGAAGGCCGACATCCGGATTCCCGAACTGGACCCGACGATCACGA
GCCTCGCGATCGACGTCGACGGACAGACGGCGCTCTATCAGCACGGCCCCGTCGCGCCGTTCGCGGTGAG
CTGGCCGGGGCCGCGCGGCGGCGTGCACGCGGAGATCACCGCGAGCCCGCGCATCCGGCCGGACACGTCG
GCGGTGTCGACGGACGGCCCATGGGCGCTGCTGCGCCTGCTTCAGAAGGGACGCGTGAGCGGCACGGCGA
CGCCCGGGCGCACGCGCGTCACGCTCGACTTCGACGGCCGCAAGGCGGTGCTCGACCTCGCGAGCACGGG
CAGCGTCGCGAATCCGCTGACGAGCGACGTGCTGAAGACGTTCAGGTGCCCGGGCTCGATGCCGATGTTC
AGTCTCGCGGACACCGGCGCGCCGCCGGGCTTGCCGCCCGGGAGCCCGGCGGCGCCGACGTCGCGCGTCG
CGCGCGACGGGCGGTGA
 Primer design