SecReT6
Protein ID: 53722515
SecReT6 ID75
T6SS typei1
Gene symbol-
Locus tagBPSS1493
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]2036034..2037980 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ63K72
KEGG IDbps:BPSS1493
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.70E-19, Aligned region: 67..126
Protein Sequence: 648 a.a.     [Download]
>gi|53722515|ref|YP_111500.1| unnamed protein product [Burkholderia pseudomallei K96243]
MSERRPPGGAAARARMPIDVEALAVLGRTDIDSAMPAGADVRADARFDALHAELAKLASPGASGQVDWRA
ATHLAAELLRERGKDLLVGCYLAGALLQTGGAAGLRCGLEIVGDLVERHWDAMSPPVSRMRARRGALQWL
VDRVDAMHDAGAAACGGACSAELVAQLRAAARRIDALLAERDDDAPTMRAVHAFAERLPVEVVEVVEVAD
EADVADVAEATEATEATEATEATEATEAADVAETAETAETAETAETAETAETAETAETAEADAHGSTGGP
AAEIAIAAAEQALIDPAGRAAPSAGTDTNANADAAGQPARLDEAAGRERALADALAQLHCVATAFAQADW
ADARGFRLRRVACWSSVCALPETDAENGRTRIAAPSASIVGAAKSIDGDGEPVAAVRFAEAHAQAFPLWL
DLQRIAARALARAGGDGADARREVETAVRALLARLPGLDALTFADGTPFADDATRAWLGELGAPVVAADA
VSPSSLPLSPRPSPPERSSPMAGEPARAPGDACGASADDAVDRACAFAASGQLDLALHAIQHAIDRATSA
EQRLRARVRLCELARDHWPHEVPEAFARGVIEPIRRHDLLAWNPELALDGLSAAYALLIRRDRESAHART
VLDEIASVDAARAMRLST
 
Nucleotide Sequence: 1947 bp     [Download]
>gi|53721039|ref|NC_006351.1|:c2037980-2036034 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGAGCGAACGGCGCCCGCCCGGCGGCGCGGCGGCGCGCGCGCGCATGCCGATCGATGTCGAAGCGCTCG
CCGTGCTGGGGCGCACGGACATCGATTCCGCCATGCCCGCGGGCGCCGACGTGCGCGCCGACGCGAGGTT
CGACGCGCTGCACGCGGAGCTTGCGAAGCTCGCGTCGCCGGGCGCGAGCGGGCAAGTCGATTGGCGCGCG
GCGACGCATCTCGCCGCCGAATTGCTGCGCGAGCGCGGCAAGGATTTGCTCGTCGGCTGCTATCTGGCGG
GTGCGTTGCTGCAGACGGGCGGCGCGGCGGGGCTGCGCTGCGGACTCGAAATCGTCGGCGATCTCGTCGA
ACGTCATTGGGATGCGATGTCGCCGCCCGTGTCGCGGATGCGGGCGAGGCGCGGGGCGCTGCAATGGCTG
GTCGATCGCGTCGACGCCATGCACGATGCAGGAGCCGCGGCATGCGGCGGCGCGTGCTCGGCCGAACTGG
TCGCGCAATTGCGCGCGGCCGCGCGGCGCATCGATGCGCTGCTCGCCGAGCGCGACGACGACGCGCCGAC
GATGCGCGCGGTGCATGCGTTCGCGGAGCGATTGCCGGTTGAGGTGGTTGAGGTGGTGGAAGTGGCTGAC
GAGGCTGATGTGGCTGATGTGGCTGAGGCGACTGAGGCGACTGAGGCGACTGAGGCGACTGAGGCGACTG
AGGCGACTGAGGCGGCTGATGTGGCTGAGACGGCTGAGACGGCTGAGACGGCTGAGACGGCCGAGACGGC
CGAGACGGCCGAGACGGCCGAGACGGCCGAGACGGCCGAGGCCGATGCGCACGGCTCGACGGGAGGGCCG
GCTGCGGAAATCGCGATTGCCGCCGCCGAACAGGCTTTGATTGATCCGGCCGGTCGAGCCGCGCCGAGCG
CAGGCACGGATACGAACGCGAACGCAGACGCCGCCGGGCAACCGGCGCGGCTCGACGAAGCGGCCGGCCG
CGAACGCGCGCTCGCCGATGCGCTCGCGCAATTGCATTGCGTCGCGACGGCGTTCGCGCAAGCGGACTGG
GCCGACGCGCGCGGCTTCCGGCTGCGCCGCGTCGCGTGCTGGTCGAGCGTGTGCGCGCTGCCGGAAACGG
ACGCGGAGAACGGAAGAACGCGGATCGCCGCGCCGAGCGCTTCGATCGTCGGCGCGGCGAAGAGCATCGA
CGGGGATGGCGAGCCCGTGGCGGCGGTGCGCTTCGCCGAAGCGCATGCGCAGGCGTTCCCGCTCTGGCTG
GATTTGCAGCGCATCGCCGCGCGCGCGCTCGCGCGCGCGGGGGGCGACGGCGCCGATGCGCGGCGCGAAG
TGGAGACGGCGGTTCGTGCGCTGCTTGCGCGGCTGCCGGGCCTCGACGCGCTGACGTTCGCGGACGGCAC
GCCGTTCGCCGACGACGCGACGCGCGCATGGCTCGGCGAGCTTGGCGCGCCTGTTGTGGCGGCGGATGCG
GTGTCGCCGTCGTCTTTGCCGCTTTCGCCGCGACCTTCGCCGCCTGAGCGATCGTCGCCGATGGCGGGCG
AACCGGCGCGCGCGCCGGGCGATGCGTGCGGGGCGAGCGCCGACGATGCAGTGGACCGAGCGTGCGCGTT
TGCCGCGAGCGGCCAGCTCGATCTCGCGCTCCACGCGATTCAGCATGCGATCGATCGTGCGACGAGCGCC
GAACAGCGGTTGAGAGCACGCGTGCGGTTGTGCGAGCTTGCGCGCGACCATTGGCCGCATGAGGTTCCTG
AGGCGTTCGCGCGCGGCGTGATCGAACCGATTCGGCGGCACGATTTGCTCGCATGGAATCCGGAGCTGGC
GCTCGACGGCTTGTCGGCCGCCTATGCGCTGCTGATTCGGCGCGATCGCGAATCGGCGCACGCGAGGACG
GTGCTTGACGAGATCGCGAGCGTCGACGCGGCGCGGGCCATGCGTTTGTCGACGTGA
 Primer design