SecReT6
Protein ID: 53722517
SecReT6 ID75
T6SS typei1
Gene symbol-
Locus tagBPSS1495
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]2038711..2040555 [-]
Producttwo-component regulator sensor kinase
NoteVirA
UniProt IDQ63K70
KEGG IDbps:BPSS1495
PDB IDNA
Domain hit(s) vs Pfam HATPase_c [PF02518], Evalue: 3.70E-21, Aligned region: 454..592
MASE1 [PF05231], Evalue: 4.40E-16, Aligned region: 62..323
HisKA [PF00512], Evalue: 0.00054, Aligned region: 311..338
HisKA [PF00512], Evalue: 0.00054, Aligned region: 337..402
Protein Sequence: 614 a.a.     [Download]
>gi|53722517|ref|YP_111502.1| unnamed protein product [Burkholderia pseudomallei K96243]
MHGNSIDAGPPARARPARITRTARAAPRRADRAFAPGGALNAAGLLLLLFYANHLLSRPGACTSLNHTLS
AVVWPAPVLGIALLLHCRRPLAWWLGAGSLFATLLAAGSLDWVPWHVDALFAAVNVVEAIAGAWLARRYL
IAGGGVDTLRGFAMFVLLLPLGMAAMHATLAAAILSVWMNDREWLSEWSRAYAANALALLVLLPALLTWN
ARACGATWSRSRNQLPVLATFGSLCFASIWGYQAEVARALLALSLSWAALEGGLVLASQLNALSAIALIA
MTLGGRGPYAWHHDGHGVWALQVDLIGVAILSMCIAIATGERRRLARQIERSRRFESLGFFAGGIVHDFS
NVLTTIDCHAEYASERLASGARADDSIDEIHRAVERGRDLAAQILLAARRGEPVLTRVSVDEVVDEALAA
TRAAAWRGVEIVRCGDGARDGARRGDVRHVVFADRSQLARAVMNLVGNAVRAARATVVVRVGVNGGVNGG
ASDGASRGANDGGAPAARAFDVAIGEASMPGGVWIEVSDDGEGIDVEPLDRIFEPFYSNRSGAPGTGLGL
AIVAGAALAHRGQIAVATDRGVGSCFRFTLPAAWGTGAPGAMDAGAPGAVQERT
 
Nucleotide Sequence: 1845 bp     [Download]
>gi|53721039|ref|NC_006351.1|:c2040555-2038711 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGCACGGAAATTCCATCGATGCCGGGCCGCCCGCGCGCGCCCGGCCCGCACGCATCACGCGAACGGCGC
GCGCCGCGCCGCGCCGCGCCGATCGCGCGTTCGCGCCGGGCGGCGCGCTGAACGCGGCGGGGCTGCTGCT
GCTGCTGTTCTACGCGAATCATCTGCTGTCCCGGCCCGGCGCGTGCACGTCGCTCAATCACACGCTGTCG
GCCGTCGTGTGGCCCGCGCCGGTGCTCGGCATCGCGCTGCTGCTGCACTGCCGGCGGCCGCTCGCATGGT
GGCTCGGCGCGGGTTCGCTGTTCGCCACGCTGCTCGCCGCGGGCTCGCTCGACTGGGTGCCGTGGCACGT
CGACGCGCTGTTCGCGGCCGTCAACGTCGTCGAGGCGATCGCGGGCGCGTGGCTCGCGCGGCGCTATCTG
ATCGCGGGCGGCGGGGTGGACACGCTGCGCGGCTTCGCGATGTTCGTGCTGCTGCTGCCGCTCGGCATGG
CGGCGATGCACGCGACGCTCGCGGCGGCGATCCTGTCGGTGTGGATGAACGACCGCGAATGGCTGAGCGA
ATGGTCGCGCGCGTATGCGGCGAACGCGCTCGCGCTGCTCGTGCTGCTGCCGGCGCTCCTCACGTGGAAC
GCGCGCGCGTGCGGCGCGACGTGGTCGCGCAGCCGCAATCAGTTGCCGGTGCTCGCGACGTTCGGCTCGC
TGTGCTTCGCGTCGATATGGGGATACCAGGCCGAGGTCGCGCGCGCGCTGCTCGCGCTGTCGCTGAGCTG
GGCCGCGCTCGAGGGCGGCCTCGTGCTCGCGTCCCAGCTCAACGCGCTCTCGGCGATCGCCCTGATCGCG
ATGACGCTCGGCGGGCGCGGCCCGTATGCGTGGCATCACGACGGCCACGGCGTCTGGGCGCTGCAGGTCG
ATCTGATCGGCGTCGCGATCCTGTCGATGTGCATCGCGATCGCGACGGGCGAGCGGCGGCGGCTCGCGCG
GCAGATCGAACGATCGCGCCGTTTCGAGTCGCTCGGCTTTTTCGCCGGCGGAATCGTGCACGATTTCAGC
AACGTGCTGACGACGATCGATTGCCACGCCGAATACGCGTCCGAGCGGCTCGCGAGCGGCGCGCGCGCGG
ACGATTCGATCGACGAGATTCATCGCGCGGTCGAACGCGGCCGCGATCTGGCGGCGCAGATCCTGCTCGC
CGCGCGCCGCGGCGAGCCCGTGCTGACGCGGGTGAGCGTCGACGAGGTTGTCGACGAGGCGCTCGCCGCG
ACACGCGCGGCCGCGTGGCGCGGCGTCGAGATCGTTCGATGCGGCGATGGCGCGCGCGACGGCGCCCGGC
GTGGCGACGTTCGTCACGTCGTATTCGCCGACCGCAGCCAGCTCGCGCGCGCGGTCATGAATCTCGTCGG
CAATGCGGTGCGCGCGGCGCGCGCGACGGTTGTCGTGCGTGTCGGGGTGAACGGCGGGGTGAACGGCGGC
GCGAGCGATGGGGCGAGCCGCGGCGCGAACGACGGCGGCGCGCCGGCCGCTCGCGCATTCGACGTCGCGA
TCGGCGAAGCGTCGATGCCGGGCGGCGTGTGGATCGAGGTGAGCGACGACGGCGAAGGCATCGACGTCGA
GCCGCTCGACCGCATCTTCGAGCCGTTCTATTCGAACCGCTCCGGCGCGCCGGGGACGGGGCTGGGTCTC
GCGATCGTCGCGGGCGCGGCGCTCGCGCACCGCGGGCAGATCGCCGTCGCGACGGATCGGGGCGTGGGCA
GTTGCTTTCGGTTCACGTTGCCGGCGGCATGGGGAACGGGCGCGCCCGGCGCAATGGACGCCGGCGCGCC
CGGCGCAGTACAGGAGAGGACATGA
 Primer design