SecReT6
Protein ID: 53722519
SecReT6 ID75
T6SS typei1
Gene symbol-
Locus tagBPSS1497
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]2041333..2042832 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ63K68
KEGG IDbps:BPSS1497
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.20E-187, Aligned region: 72..497
Protein Sequence: 499 a.a.     [Download]
>gi|53722519|ref|YP_111504.1| unnamed protein product [Burkholderia pseudomallei K96243]
MEGEHLQSPKHDDAPDATPPESPASLLDELIEAARVKRDEDAYPITRHGIQAFVAHLAKPKRPIETVSQA
TIDDMIAEIDRKLCRQIDAILHDPAFQQLESTWRSLKFLVDRTDFRENVKVQILDVGKTALFDDFEDSPD
ITKSGLYQKVYTAEYGQFGGQPIGAIVANYTFGPGAQDVKLLQYVASTSAMAHTPFIAAAGPAFFGIDSF
GKLPNVKDLASLFEGPQYAKWNAFRESEDARYVGLTLPRFLLRLPYGANTTPVKRFNYEERVDGGDAHFL
WGNAAFAFATRLTASFADYRWCANVIGPKGGGTVTDLPLYAYESMGEIQNKIPTDVLISERREFELAEQG
FIALTMRKNSDNAAFFSANSTQKPKFFGISKEGKEAELNYRLSTQLPYIFVVNRLAHYIKVIQRENIGSW
KERGDLEQELNQWIRQYVVDMDNPSQSVRSRRPLRQAQIVVSDVEGEPGWYRVDMKVRPHFKYMGAFFTL
SLVGKLEKR
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|53721039|ref|NC_006351.1|:2041333-2042832 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGGAAGGCGAACACCTGCAATCCCCGAAGCACGACGACGCGCCGGACGCGACGCCGCCCGAGTCCCCCG
CCTCGCTGCTCGACGAGCTGATCGAGGCCGCGCGCGTGAAGCGCGACGAAGACGCATACCCGATCACGCG
CCACGGCATCCAGGCGTTCGTCGCGCATCTGGCGAAGCCCAAGCGCCCGATCGAGACCGTGAGCCAGGCG
ACGATCGACGACATGATCGCCGAGATCGACCGCAAGCTGTGCCGGCAGATCGACGCGATCCTCCATGACC
CGGCATTCCAGCAACTCGAATCGACGTGGCGCTCGCTGAAGTTTCTCGTCGATCGAACGGATTTCCGCGA
GAACGTGAAGGTTCAGATTCTCGACGTCGGCAAAACGGCGCTGTTCGACGACTTCGAGGATTCGCCCGAC
ATCACGAAATCCGGGCTGTACCAGAAGGTCTATACGGCCGAGTACGGCCAATTCGGCGGCCAGCCGATCG
GCGCGATCGTCGCGAACTACACGTTCGGGCCCGGCGCGCAGGACGTCAAGCTGCTGCAGTACGTCGCGAG
CACGTCGGCGATGGCGCATACGCCGTTCATCGCGGCGGCGGGCCCCGCGTTCTTCGGCATCGATTCGTTC
GGCAAGCTGCCGAACGTAAAGGATCTCGCCTCGCTGTTCGAGGGGCCGCAATACGCGAAATGGAATGCGT
TTCGCGAAAGCGAGGACGCGCGCTACGTCGGCCTCACGCTGCCGCGCTTCTTGCTGCGGCTGCCTTACGG
CGCGAACACGACGCCCGTCAAGCGCTTCAACTACGAGGAGCGCGTCGACGGCGGCGACGCGCATTTTCTG
TGGGGCAACGCGGCGTTCGCGTTCGCGACGCGCCTCACCGCGAGCTTCGCCGACTATCGCTGGTGCGCGA
ACGTGATCGGGCCGAAAGGCGGCGGAACGGTGACCGATCTGCCGCTCTACGCGTACGAATCGATGGGCGA
GATCCAGAACAAGATCCCGACCGACGTGCTGATTTCCGAGCGCCGCGAGTTCGAGCTCGCCGAACAGGGC
TTCATCGCGCTGACGATGCGCAAGAACAGCGACAACGCCGCCTTTTTCTCCGCGAACTCCACGCAGAAGC
CGAAGTTCTTCGGCATCAGCAAGGAAGGCAAGGAGGCCGAGCTCAACTATCGGCTCAGCACGCAACTGCC
GTACATCTTCGTCGTCAACCGGCTCGCCCATTACATCAAGGTGATCCAGCGGGAAAACATCGGCTCGTGG
AAGGAGCGCGGCGATCTCGAGCAGGAGCTCAACCAGTGGATCCGCCAGTACGTCGTCGACATGGACAACC
CGTCGCAGAGCGTGCGCAGCCGCCGCCCGCTGCGGCAGGCGCAGATCGTCGTGTCGGACGTCGAGGGCGA
ACCCGGCTGGTATCGCGTGGACATGAAGGTGCGGCCGCACTTCAAGTACATGGGCGCGTTCTTCACGCTG
TCGCTCGTCGGCAAGCTCGAAAAGCGCTAG
 Primer design