SecReT6
Protein ID: 53722521
SecReT6 ID75
T6SS typei1
Gene symbol-
Locus tagBPSS1499
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]2043554..2044015 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ63K66
KEGG IDbps:BPSS1499
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.70E-19, Aligned region: 39..130
Protein Sequence: 153 a.a.     [Download]
>gi|53722521|ref|YP_111506.1| unnamed protein product [Burkholderia pseudomallei K96243]
MADRESSRAGEPRTRERRLLERIANREAGGEHDRPPPADVLAHSIIDHLRRILNTRQGHVPIDPAFGVPD
FTNLAGGFAQGSAREIEAQIERVITCYEPRLKAPRVSLAERGPDAATLRFSLDARLVIDAHDVPARFLTT
VTGNGKIDIRTIS
 
Nucleotide Sequence: 462 bp     [Download]
>gi|53721039|ref|NC_006351.1|:2043554-2044015 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGGCTGATCGCGAATCGTCGCGGGCCGGCGAGCCGCGCACGCGCGAGCGCCGGCTGCTCGAGCGGATCG
CGAACCGGGAAGCGGGCGGCGAGCACGATCGCCCGCCGCCCGCCGACGTGCTCGCGCACTCGATCATCGA
CCACCTGCGCCGCATCCTGAACACGCGGCAGGGCCACGTGCCGATCGATCCCGCCTTCGGCGTGCCGGAT
TTCACGAATCTCGCGGGCGGCTTCGCGCAAGGCTCCGCCCGCGAAATCGAAGCGCAGATCGAGCGCGTGA
TCACCTGCTACGAGCCGCGGCTGAAAGCGCCGCGCGTCTCGCTCGCCGAGCGCGGGCCCGATGCGGCGAC
GCTGCGCTTCAGCCTCGATGCGCGGCTCGTGATCGACGCGCACGACGTGCCGGCGCGCTTTCTGACGACC
GTCACCGGCAACGGAAAGATCGATATCCGAACGATTTCCTGA
 Primer design