SecReT6
Protein ID: 53722524
SecReT6 ID75
T6SS typei1
Gene symbol-
Locus tagBPSS1502
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]2046791..2049829 [+]
ProductClp-type ATPase chaperone protein
NoteTssH
UniProt IDQ63K63
KEGG IDbps:BPSS1502
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-41, Aligned region: 226..244
AAA_2 [PF07724], Evalue: 1.20E-41, Aligned region: 685..852
AAA [PF00004], Evalue: 1.00E-19, Aligned region: 227..336
AAA [PF00004], Evalue: 1.00E-19, Aligned region: 691..809
ClpB_D2-small [PF10431], Evalue: 5.30E-14, Aligned region: 857..929
AAA_5 [PF07728], Evalue: 1.70E-13, Aligned region: 227..245
AAA_5 [PF07728], Evalue: 1.70E-13, Aligned region: 690..804
AAA_22 [PF13401], Evalue: 8.70E-10, Aligned region: 224..310
AAA_22 [PF13401], Evalue: 8.70E-10, Aligned region: 393..439
AAA_22 [PF13401], Evalue: 8.70E-10, Aligned region: 689..784
AAA_16 [PF13191], Evalue: 4.30E-09, Aligned region: 37..117
AAA_16 [PF13191], Evalue: 4.30E-09, Aligned region: 202..247
AAA_16 [PF13191], Evalue: 4.30E-09, Aligned region: 269..307
AAA_16 [PF13191], Evalue: 4.30E-09, Aligned region: 661..726
AAA_16 [PF13191], Evalue: 4.30E-09, Aligned region: 755..784
AAA_16 [PF13191], Evalue: 4.30E-09, Aligned region: 828..891
AAA_16 [PF13191], Evalue: 4.30E-09, Aligned region: 892..926
Zeta_toxin [PF06414], Evalue: 3.10E-06, Aligned region: 225..245
Zeta_toxin [PF06414], Evalue: 3.10E-06, Aligned region: 305..353
Zeta_toxin [PF06414], Evalue: 3.10E-06, Aligned region: 684..731
Clp_N [PF02861], Evalue: 1.20E-05, Aligned region: 28..75
AAA_19 [PF13245], Evalue: 1.20E-05, Aligned region: 116..131
AAA_19 [PF13245], Evalue: 1.20E-05, Aligned region: 220..247
AAA_19 [PF13245], Evalue: 1.20E-05, Aligned region: 437..467
AAA_19 [PF13245], Evalue: 1.20E-05, Aligned region: 590..605
AAA_19 [PF13245], Evalue: 1.20E-05, Aligned region: 688..722
AAA_19 [PF13245], Evalue: 1.20E-05, Aligned region: 891..915
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 225..302
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 461..512
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 686..711
IstB_IS21 [PF01695], Evalue: 0.00013, Aligned region: 219..253
IstB_IS21 [PF01695], Evalue: 0.00013, Aligned region: 690..726
Sigma54_activat [PF00158], Evalue: 0.00021, Aligned region: 221..239
Sigma54_activat [PF00158], Evalue: 0.00021, Aligned region: 689..806
AAA_17 [PF13207], Evalue: 0.00024, Aligned region: 227..249
AAA_17 [PF13207], Evalue: 0.00024, Aligned region: 690..726
Arch_ATPase [PF01637], Evalue: 0.0003, Aligned region: 203..239
Arch_ATPase [PF01637], Evalue: 0.0003, Aligned region: 276..362
Arch_ATPase [PF01637], Evalue: 0.0003, Aligned region: 689..711
ResIII [PF04851], Evalue: 0.00034, Aligned region: 210..246
ResIII [PF04851], Evalue: 0.00034, Aligned region: 292..307
ResIII [PF04851], Evalue: 0.00034, Aligned region: 661..724
TIP49 [PF06068], Evalue: 0.00057, Aligned region: 226..251
TIP49 [PF06068], Evalue: 0.00057, Aligned region: 273..305
TIP49 [PF06068], Evalue: 0.00057, Aligned region: 690..725
AAA_10 [PF12846], Evalue: 0.00093, Aligned region: 223..245
AAA_10 [PF12846], Evalue: 0.00093, Aligned region: 288..313
AAA_10 [PF12846], Evalue: 0.00093, Aligned region: 400..488
AAA_10 [PF12846], Evalue: 0.00093, Aligned region: 690..837
NACHT [PF05729], Evalue: 0.0015, Aligned region: 227..253
NACHT [PF05729], Evalue: 0.0015, Aligned region: 690..711
Torsin [PF06309], Evalue: 0.0047, Aligned region: 648..716
AAA_14 [PF13173], Evalue: 0.0066, Aligned region: 278..328
AAA_14 [PF13173], Evalue: 0.0066, Aligned region: 689..772
AAA_18 [PF13238], Evalue: 0.0067, Aligned region: 228..245
AAA_18 [PF13238], Evalue: 0.0067, Aligned region: 691..732
Protein Sequence: 1012 a.a.     [Download]
>gi|53722524|ref|YP_111509.1| unnamed protein product [Burkholderia pseudomallei K96243]
MLLVDLKPLIEQLNPYCRNALESAVGACVARRHDDVAVEHLLARLCDEPSADVALLLRACGADAARLRRQ
ADAALDARPAGDGGRPAFAPSLLALLQDAWLIASLELGDTHIRSAAVLAAAVARAARQPSPGGDDVLQSL
RKDALVARFASGACARSIESRASGALDAAPGEASDTRDASSAIARYCEDFTAKARAGGIDPVFGRDAEIR
QIVDILARRRKNNPVCVGEPGVGKTAVVEGLALRIAEGDVPATLRGATLLGLDLGMLQAGASVKGEFEQR
LKRVIAEIRASQTPVVLFIDEAHTLIGAGGAAGASDAANLLKPALARGELRTIAATTWSEYKKYFEKDAA
LARRFQPVKLDSPNVATSVMILRGLKERYQDAHGVTIRDDALVAAAELSARYITGRQLPDKAIDLLDTAC
ARVKVRQQTKPAALEDAQRAIQALERERRALRDELAERCAPDTPRVADIDRELAALSARAGALRDAWAAQ
RDAAQALVDARRACRAAADATDAAGTTGTAHAGELADSADVSDIADVAKMADAADAAPADAETGSNARDA
DVRMPAGTCARIAPNPDARARPPLRAPHADARERAARALAEATRRFEHAQRDTPLVRIDVDPDAIADVVA
DWTGIAAGKLRRDRANVMLRLADTLRRRIRGQDHAIEQISEAVKAGAAGVHDPRRPLGVFLLAGPSGTGK
TETALAVADALFGDERSIVVVNMSEFQERHDVSRLIGSPPGYVGYGEGGMLTEAVRQRPYSVVLLDEVEK
AHPDVLNLFYQVFDKGSLSDGEGKEVDFANTVIFLTSNLGADIIADIAARGARPDPDAMRAAVRPALSRH
FKPALLARMTEIPYAPLAPDTLADIARLKLERIAARVAAQHATRIVYDDAVVAHVAARCTEVESGARNVD
FILQRHVLPALAQHVLVCAGNAAPMPAIRVAIDAGGRFVVSNDAPADSDARDRSDASDASDASDAIDAVD
AVDAVDAPNAPNAPNAPNAPNAPNAPNAPNAR
 
Nucleotide Sequence: 3039 bp     [Download]
>gi|53721039|ref|NC_006351.1|:2046791-2049829 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGCTGCTGGTTGACCTGAAACCGTTGATCGAACAGCTCAACCCCTATTGCCGGAACGCGCTCGAAAGCG
CCGTCGGCGCGTGCGTCGCGCGCCGGCACGACGACGTCGCCGTCGAGCACCTGCTCGCGCGGCTGTGCGA
CGAACCGTCGGCCGACGTCGCGCTGTTGCTGCGCGCGTGCGGCGCGGACGCGGCGCGCCTGCGCCGGCAG
GCCGACGCCGCGCTCGACGCGCGCCCGGCGGGCGACGGCGGCCGCCCCGCGTTCGCGCCGTCGCTGCTCG
CGCTGTTGCAGGACGCGTGGCTGATCGCGTCGCTCGAGCTCGGCGACACGCACATCCGCTCGGCGGCCGT
GCTCGCCGCCGCGGTCGCCCGCGCGGCGCGGCAGCCGTCGCCCGGCGGCGACGACGTGCTGCAGTCGCTG
CGCAAGGACGCGCTCGTCGCGCGCTTTGCGAGCGGCGCGTGCGCGCGATCGATCGAATCGCGCGCGTCCG
GCGCGCTCGACGCCGCGCCGGGCGAGGCGAGCGACACGCGCGACGCATCGAGCGCGATCGCCCGCTACTG
CGAGGACTTCACCGCGAAAGCGCGCGCCGGCGGGATCGATCCGGTCTTCGGTCGCGACGCGGAAATCCGC
CAGATCGTCGACATCCTCGCGCGGCGGCGCAAGAACAATCCGGTGTGCGTCGGCGAGCCGGGCGTGGGCA
AGACGGCCGTCGTCGAAGGGCTCGCGCTGCGGATCGCCGAAGGCGACGTGCCGGCGACGCTGCGCGGCGC
GACGCTGCTCGGCCTCGACCTCGGCATGCTGCAGGCGGGCGCGAGCGTGAAGGGCGAATTCGAGCAGCGG
CTCAAGCGCGTGATCGCCGAGATCCGCGCGTCGCAAACGCCCGTCGTGCTGTTCATCGACGAAGCGCACA
CGCTGATCGGCGCGGGCGGCGCGGCGGGCGCGTCCGACGCGGCGAACCTGCTGAAGCCCGCGCTCGCGCG
CGGCGAGCTGCGCACGATCGCGGCCACCACGTGGAGCGAATACAAGAAGTATTTCGAGAAGGACGCGGCG
CTCGCGCGGCGCTTCCAGCCGGTGAAGCTCGACAGCCCGAACGTCGCGACGTCGGTGATGATCCTGCGCG
GGCTGAAGGAGCGCTATCAGGACGCGCACGGCGTGACGATCCGCGACGACGCGCTCGTCGCCGCGGCCGA
GCTGTCGGCGCGCTACATCACCGGTCGGCAGTTGCCGGACAAGGCGATCGACCTGCTCGACACCGCGTGC
GCGCGCGTGAAGGTGCGCCAGCAGACCAAGCCCGCCGCGCTGGAGGACGCGCAGCGCGCGATCCAGGCGC
TCGAGCGCGAGCGGCGCGCGCTGCGCGACGAATTGGCCGAGCGCTGCGCGCCGGATACGCCGCGCGTCGC
CGACATCGATCGCGAGCTCGCCGCGCTGTCCGCGCGCGCCGGCGCGCTGCGCGACGCGTGGGCGGCGCAG
CGCGACGCCGCGCAGGCGCTCGTCGACGCACGCCGCGCGTGCCGGGCGGCGGCGGATGCAACGGATGCGG
CTGGAACGACCGGAACGGCCCATGCCGGCGAGCTCGCCGATAGTGCCGACGTTTCCGATATCGCCGATGT
CGCCAAGATGGCCGATGCGGCCGACGCCGCCCCTGCCGATGCCGAAACCGGCTCGAACGCCCGCGACGCC
GACGTACGCATGCCCGCCGGGACGTGCGCGCGCATCGCCCCGAACCCGGATGCGCGGGCGCGGCCCCCTT
TGCGCGCGCCGCACGCCGACGCGCGCGAGCGCGCGGCTCGTGCGCTCGCCGAAGCGACGCGCCGCTTCGA
GCACGCGCAGCGCGACACGCCGCTCGTGCGAATCGACGTCGATCCGGACGCGATCGCCGACGTCGTGGCC
GACTGGACCGGCATCGCGGCCGGCAAGCTGCGCCGCGATCGCGCGAACGTGATGCTGCGGCTCGCCGATA
CGCTGCGCCGCCGCATCCGCGGCCAGGATCACGCGATCGAACAGATCTCCGAAGCCGTGAAGGCGGGCGC
GGCCGGCGTCCACGATCCGCGCCGCCCGCTCGGCGTGTTCCTGCTCGCGGGGCCGTCGGGCACCGGCAAG
ACCGAGACCGCGCTCGCGGTCGCCGATGCGCTGTTCGGCGACGAGCGCTCGATCGTCGTCGTCAACATGA
GCGAATTCCAGGAGCGGCACGACGTGAGCCGCCTGATCGGCTCGCCGCCGGGCTACGTCGGCTACGGCGA
GGGCGGGATGCTGACCGAGGCGGTGCGCCAGCGGCCCTATTCGGTCGTGCTGCTAGACGAAGTCGAGAAG
GCGCACCCCGACGTGCTGAACCTGTTCTACCAGGTGTTCGACAAGGGTTCGCTGTCCGACGGCGAAGGCA
AGGAGGTCGACTTCGCGAACACGGTGATCTTCCTCACGTCGAATCTCGGCGCGGACATCATCGCCGACAT
CGCCGCACGCGGCGCGCGGCCCGATCCGGACGCGATGCGCGCGGCGGTGCGCCCGGCGCTGTCGCGCCAT
TTCAAGCCGGCGCTGCTCGCGCGGATGACCGAGATTCCGTATGCGCCGCTCGCGCCCGATACGCTCGCCG
ACATCGCGCGGCTGAAGCTCGAGCGCATCGCGGCGCGCGTCGCCGCGCAGCACGCGACGCGCATCGTCTA
CGACGACGCCGTCGTCGCGCACGTCGCCGCGCGCTGCACCGAAGTCGAATCGGGCGCGCGCAACGTCGAT
TTCATCCTGCAGCGCCACGTGCTGCCCGCGCTCGCGCAGCACGTGCTCGTGTGCGCGGGCAACGCGGCGC
CGATGCCTGCGATTCGCGTCGCCATCGACGCCGGCGGCCGCTTCGTCGTCTCGAACGACGCGCCGGCCGA
CTCCGATGCACGGGACCGGAGCGATGCGTCCGATGCGTCCGATGCGTCTGATGCGATCGACGCGGTCGAC
GCGGTCGATGCGGTCGATGCACCCAACGCACCCAACGCACCCAACGCACCCAACGCACCCAACGCACCCA
ACGCACCCAACGCACCCAACGCACGCTGA
 Primer design