SecReT6
Protein ID: 53722530
SecReT6 ID75
T6SS typei1
Gene symbol-
Locus tagBPSS1508
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]2057929..2058606 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ63K57
KEGG IDbps:BPSS1508
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.60E-25, Aligned region: 6..168
Protein Sequence: 225 a.a.     [Download]
>gi|53722530|ref|YP_111515.1| unnamed protein product [Burkholderia pseudomallei K96243]
MLVALAALAGCAARVTEEQARADVRWDYAPDALRIDIDASARLNEYLNAPHTLLLAVFQSADAKAFRQLA
DDPDRLRMTLAAGGPAADFIQTTRYVVAPGQHVALSIDRAQQARYVGIVAGYYDADGPRAARLFEVPLRI
DKRGWFSSTYRAAPRTLELKLRLGAQSITDAREAPLNLPPPGARAWTALDSGAKTLALPSADANEGGSGK
RDKRGNAAARAPRKQ
 
Nucleotide Sequence: 678 bp     [Download]
>gi|53721039|ref|NC_006351.1|:2057929-2058606 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
GTGCTCGTCGCGCTCGCCGCCCTCGCCGGCTGTGCGGCCCGCGTCACCGAAGAGCAGGCGCGCGCCGACG
TGCGATGGGACTACGCGCCCGACGCGCTGCGCATCGATATCGACGCGTCGGCGCGGTTGAACGAATACCT
GAACGCGCCGCACACGCTGTTGCTCGCGGTGTTCCAGAGCGCGGACGCGAAGGCGTTCCGCCAGCTCGCC
GACGATCCGGACCGGCTGCGCATGACGCTCGCGGCGGGCGGCCCCGCCGCGGACTTCATTCAGACGACCC
GCTACGTCGTCGCGCCCGGCCAGCATGTCGCGCTGTCGATCGATCGCGCGCAGCAGGCGCGCTACGTCGG
CATCGTCGCCGGCTACTACGACGCCGACGGCCCACGCGCGGCGCGCCTGTTCGAGGTGCCGCTGCGCATC
GACAAGCGCGGCTGGTTCTCCTCCACCTATCGCGCCGCGCCGCGAACGCTCGAGCTGAAGCTCAGGCTCG
GCGCGCAGAGCATCACCGACGCGCGCGAAGCGCCGCTGAACCTGCCGCCGCCGGGCGCGCGCGCATGGAC
GGCGCTCGACAGCGGCGCGAAGACCCTGGCGCTGCCGAGCGCCGACGCGAACGAGGGCGGCAGCGGCAAG
CGCGACAAACGCGGCAACGCCGCCGCCCGTGCGCCGCGCAAGCAATGA
 Primer design