SecReT6
Protein ID: 53722532
SecReT6 ID75
T6SS typei1
Gene symbol-
Locus tagBPSS1510
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]2060051..2060698 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ63K55
KEGG IDbps:BPSS1510
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.10E-42, Aligned region: 2..202
Protein Sequence: 215 a.a.     [Download]
>gi|53722532|ref|YP_111517.1| unnamed protein product [Burkholderia pseudomallei K96243]
MMPLVAYARQLAQSPRGDAAEVALRLDILIERARDHAACAGAPAADVDDALFAVCAWIDEALLNSGWDDA
DRWTLRLLQKRYFDTSHAGVVFFERLGTLDGARASVLEVYLLCLRLGFRGRYGYDGGDGPLDAIRQRALD
ALSAHAPPCAAGEPPFPAAYAHAGPHAAAAKARTRRRIARAGLSVGLPLAVLLSLYLIYHVVIVRMVDAV
YPRLQ
 
Nucleotide Sequence: 648 bp     [Download]
>gi|53721039|ref|NC_006351.1|:2060051-2060698 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGATGCCGCTCGTCGCGTATGCGCGGCAGCTCGCGCAATCGCCGCGCGGCGACGCCGCCGAAGTCGCGC
TGCGGCTCGACATCCTGATCGAGCGCGCGCGCGACCACGCGGCGTGCGCGGGCGCACCCGCGGCCGACGT
CGACGACGCGCTGTTCGCTGTGTGCGCGTGGATCGACGAGGCGCTGCTGAACAGCGGCTGGGACGATGCC
GATCGCTGGACGCTGCGGCTGCTGCAAAAGCGCTACTTCGATACGTCGCACGCGGGCGTCGTGTTCTTCG
AACGCCTCGGCACGCTCGACGGCGCGCGCGCGAGCGTGCTCGAGGTCTACCTGCTGTGCCTGCGGCTCGG
CTTTCGCGGCCGCTACGGCTACGACGGCGGCGACGGCCCGCTCGACGCGATCCGGCAGCGCGCGCTCGAT
GCACTGTCGGCGCACGCGCCGCCGTGCGCCGCGGGCGAGCCGCCGTTTCCCGCCGCCTATGCGCACGCCG
GCCCGCACGCCGCCGCCGCGAAAGCGCGCACGCGCCGCCGGATCGCGCGCGCGGGGCTGAGCGTCGGGCT
GCCGCTCGCCGTCCTGCTGTCGCTCTATCTGATCTATCACGTCGTCATCGTGCGGATGGTCGACGCGGTG
TACCCCAGGCTGCAATGA
 Primer design