SecReT6
Protein ID: 53722533
SecReT6 ID75
T6SS typei1
Gene symbol-
Locus tagBPSS1511
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]2060710..2064669 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ63K54
KEGG IDbps:BPSS1511
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.40E-48, Aligned region: 171..416
ImcF-related_N [PF14331], Evalue: 1.40E-48, Aligned region: 1078..1118
Protein Sequence: 1319 a.a.     [Download]
>gi|53722533|ref|YP_111518.1| unnamed protein product [Burkholderia pseudomallei K96243]
MMIARIAALLALAALSWASALYFDWPLWCAPAVFCAALAGWLLCRVARRALRAVRARAQLARLDASERLP
AADAPELRVAARWRTALAALGRAQPAPRLRGRPRDALPWYLVIGPEGAGKTTALARARLVSPLRHARDDA
AIAPTEDCDWWCFDDAVVLDLAGRFAAPGATDDDRRAWHALLEQLGRARARRGVNGVVVAIDAPRLIEAS
RDALTIEGSAIRERLEQLIRLFDRRFPVYVLVTQCDRLYGFDEWAAQLAPEQRERAFGYLGDHDADAFVA
RALDSLDARLGALRVALAARGEPPSPRALMLPHELACLRPALEAFARAAFGPNVYQETPYLRGLLFASGR
QAGGAPSLTLPDWLDAAPARTPGDAGLFLHDLFARVLPGERDAWLPVERPSRSRLVLRRLALAAWLLASI
AAGLLMSASFVGDMRTVELVRRDYPAHPRFTGEFAHDTATLERIGRVIADVERRDERRLVRPLAGATPVG
RLEAELKRRYVAHYRRSIEPTADRLFFGEPDGASDVRAADDARLAARIRNLVRYVNLMQARRRGADRETL
AQMPAPAVARATDGGGARGVDSVGVSGVSGVSGVSGGVGGVGGARAAEGAGRAVRASGGRRAGDARAARG
MRGAAGNAGAGAEIAPAADGVRDRDEGFARVSALAVDLIAWSAPDDRALAARVAAAQAELERLAYRDPDG
AWLLALPDASMPRDVTLADFWPAAEPRTLPDAQPAALRDVRVPAALTAAHRPAIDAFLDEMAQAVANRPK
FAFHRDAFDTWYRARRIDAWRDFVARFPQGEQGLTTQAQWRAVIDRIADRRDPFSALLARVDREFESERD
DTLPPWLRFVRTTSHMLAPAMLAPARLPAASGGLGAALGSISRSGGRALREALGGAPEQGRLTLERDAAL
RDALVDYERRVAALAADALAGPGAAYRLAADFHGFGVDPSVQASAMRAADSALRDVKRLAGDRDVGGDVV
WSLVGGPLRALIAYVERQASCALQDDWERDVLWPLRRAATRDDVEGLLYGPQGAIWAFVDGPAKPFVRVG
AARASALDTLGYRLPFTDAFLPLIDDAAARRVAQARRDAERRAQQQAALELDERIASLGKQIDALRAQTV
RFGIVAQPTDVNPDAQAKPFETVLTLQCAPQARTLTNYNLRVSEQIDWQPDRCGDATLRISLGGVTLVRR
YAGSLGVARFVQDFRYGVRRFTPRDFPDAKAQLQRLGVRHIDVRYDFSGHDALLAHVGRIDALERARRDD
LARQRRAANRQDDDAGGATAIARAAASVANAPGAALPRRIGVCWGDPAHDRPDGDGAQP
 
Nucleotide Sequence: 3960 bp     [Download]
>gi|53721039|ref|NC_006351.1|:2060710-2064669 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGATGATCGCGCGGATCGCCGCGCTGCTCGCGCTCGCCGCGCTCAGTTGGGCGAGCGCGCTCTATTTCG
ACTGGCCGCTGTGGTGCGCGCCCGCCGTGTTCTGCGCGGCGCTCGCCGGATGGCTGCTGTGCCGCGTCGC
GCGCCGCGCGCTGCGCGCGGTTCGTGCGCGCGCGCAGCTCGCACGGCTCGACGCATCCGAGCGCCTGCCC
GCGGCCGACGCGCCGGAGCTGCGCGTCGCCGCGCGCTGGCGCACCGCGCTCGCCGCGCTCGGGCGCGCGC
AGCCCGCGCCGCGCCTGCGCGGCCGGCCGCGCGACGCGCTGCCGTGGTATCTCGTGATCGGCCCCGAGGG
CGCGGGCAAGACAACCGCGCTCGCACGCGCGCGCCTCGTGTCGCCGCTGCGGCACGCGCGCGACGACGCG
GCCATCGCGCCGACCGAGGACTGCGACTGGTGGTGCTTCGACGACGCGGTCGTGCTCGATCTCGCGGGCC
GCTTCGCCGCGCCCGGCGCGACCGACGACGATCGCCGCGCATGGCACGCGCTCCTCGAGCAGCTCGGCCG
CGCGCGTGCGCGCCGGGGCGTGAACGGCGTCGTGGTCGCGATCGACGCGCCGCGCCTCATCGAAGCGAGC
CGCGATGCGCTGACGATCGAAGGCAGCGCCATTCGCGAACGGCTCGAGCAACTGATCCGCCTGTTCGACC
GGCGCTTTCCGGTGTACGTGCTCGTCACGCAATGCGACCGGCTCTACGGCTTCGACGAATGGGCCGCGCA
GCTCGCGCCGGAACAACGCGAGCGCGCGTTCGGCTATCTCGGCGATCACGACGCGGATGCGTTCGTCGCG
CGCGCGCTCGACAGCCTCGACGCACGGCTCGGCGCGCTGCGCGTCGCGCTGGCGGCGCGCGGCGAGCCGC
CGTCGCCGCGCGCGCTGATGCTGCCGCACGAACTCGCGTGCCTGCGGCCCGCGCTCGAGGCGTTCGCACG
CGCGGCGTTCGGCCCGAACGTCTATCAGGAAACACCGTATCTGCGCGGGCTGCTGTTCGCGAGCGGCCGG
CAGGCGGGCGGCGCGCCGTCGCTGACGCTGCCCGACTGGCTCGACGCCGCGCCGGCGCGCACGCCCGGCG
ATGCGGGCCTGTTCCTGCACGACTTGTTCGCGCGCGTGCTGCCGGGCGAGCGCGACGCGTGGCTGCCCGT
CGAGCGGCCGAGCCGCTCGCGGCTCGTGCTGCGGCGCCTCGCGCTCGCCGCGTGGCTCCTCGCGAGCATC
GCGGCCGGGCTGCTGATGAGCGCATCGTTCGTCGGCGACATGCGAACCGTCGAGCTGGTCCGCCGCGACT
ATCCCGCGCATCCGCGCTTCACCGGCGAATTCGCGCACGACACGGCGACGCTCGAGCGGATCGGCCGCGT
GATCGCCGACGTCGAGCGGCGCGACGAGCGGCGGCTCGTGCGCCCGCTCGCCGGCGCGACGCCCGTCGGC
CGGCTCGAAGCGGAACTCAAGCGCCGCTACGTCGCGCACTATCGGCGCTCGATCGAACCCACCGCCGATC
GGCTGTTCTTCGGCGAGCCGGACGGCGCGAGCGACGTGCGCGCGGCCGACGATGCGCGGCTCGCCGCGCG
CATCCGCAATCTGGTCCGCTACGTGAACCTGATGCAGGCGCGCCGGCGCGGCGCGGATCGCGAGACGCTC
GCGCAAATGCCCGCACCGGCGGTCGCGCGCGCGACGGATGGCGGTGGCGCTCGCGGAGTGGACAGTGTGG
GTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGCGGTGTAGGCGGTGTAGGCGGTGCGCGCGCCGC
GGAAGGTGCGGGTCGCGCCGTCCGCGCGAGCGGCGGACGGCGCGCAGGCGACGCGCGCGCCGCGCGCGGC
ATGCGCGGCGCCGCCGGCAACGCCGGCGCCGGCGCTGAAATCGCACCCGCCGCAGACGGCGTTCGCGATC
GCGACGAAGGGTTTGCGCGCGTCAGCGCGCTCGCCGTCGACCTGATCGCGTGGAGCGCGCCCGACGATCG
CGCGCTCGCCGCGCGCGTCGCGGCCGCGCAGGCAGAGCTCGAACGGCTCGCGTACCGCGATCCGGACGGC
GCGTGGCTGCTCGCGCTACCGGATGCCTCGATGCCGCGCGACGTGACGCTCGCCGATTTCTGGCCCGCCG
CCGAGCCGCGCACGCTGCCCGACGCACAGCCCGCCGCGCTGCGCGACGTGCGCGTGCCCGCCGCGCTGAC
GGCCGCGCATCGCCCGGCCATCGATGCGTTCCTCGACGAGATGGCGCAGGCGGTCGCGAACCGGCCGAAG
TTCGCGTTCCATCGCGACGCGTTCGACACGTGGTACCGCGCACGGCGCATCGACGCATGGCGCGACTTCG
TCGCACGCTTCCCGCAGGGCGAGCAAGGGCTGACGACGCAAGCGCAATGGCGCGCGGTGATCGACCGGAT
CGCCGATCGCCGCGATCCGTTCTCGGCATTGCTCGCGCGCGTCGATCGCGAATTCGAATCCGAGCGCGAC
GACACGCTGCCGCCGTGGCTACGGTTCGTGCGCACGACATCGCACATGCTCGCCCCCGCGATGCTCGCGC
CCGCGCGCCTGCCCGCGGCGAGCGGCGGCCTGGGCGCCGCGCTCGGCTCGATCTCGCGCAGCGGCGGACG
CGCGCTGCGCGAAGCGCTCGGCGGCGCACCCGAGCAAGGCAGGCTCACGCTCGAGCGCGACGCCGCGCTG
CGCGACGCGCTTGTCGACTACGAGCGGCGCGTCGCCGCGCTCGCCGCCGACGCGCTTGCGGGCCCCGGCG
CCGCGTACCGGCTCGCGGCCGATTTCCACGGCTTCGGCGTCGATCCGTCCGTCCAGGCTTCCGCGATGCG
CGCGGCCGACAGCGCGCTGCGCGACGTCAAGCGGCTCGCGGGCGATCGCGACGTCGGCGGCGACGTCGTC
TGGAGCCTCGTCGGCGGCCCGCTGCGCGCGCTGATCGCGTATGTCGAGCGGCAGGCGTCGTGCGCGCTGC
AGGACGACTGGGAGCGCGACGTGCTGTGGCCGCTCAGGCGCGCGGCGACGCGCGACGACGTGGAGGGTCT
GCTGTACGGCCCGCAAGGCGCGATCTGGGCGTTCGTCGACGGCCCGGCGAAGCCGTTCGTGCGTGTCGGC
GCGGCGCGTGCATCGGCGCTCGACACGCTCGGCTACCGGCTGCCGTTCACCGACGCGTTCCTGCCGCTCA
TCGACGACGCGGCCGCCCGGCGCGTCGCGCAAGCGCGGCGCGACGCCGAGCGGCGCGCGCAACAGCAGGC
GGCGCTCGAGCTGGACGAGCGGATCGCATCGCTCGGCAAGCAGATCGACGCGCTGCGCGCGCAAACGGTG
CGCTTCGGGATCGTCGCGCAGCCGACCGACGTGAACCCGGATGCGCAGGCCAAGCCGTTCGAAACCGTGC
TGACGCTGCAATGCGCGCCGCAGGCGCGCACGCTGACGAACTACAACCTGCGCGTGTCCGAGCAGATCGA
CTGGCAACCCGATCGATGCGGCGACGCGACGCTGCGCATCTCGCTCGGCGGCGTCACGCTCGTGCGCCGT
TACGCGGGATCGCTCGGCGTCGCGCGCTTCGTCCAGGACTTCCGCTACGGCGTGCGCCGCTTCACGCCCC
GCGATTTCCCGGACGCGAAAGCGCAGCTTCAACGTCTCGGCGTGCGCCACATCGACGTGCGTTACGACTT
CTCCGGGCATGACGCGCTGCTCGCGCACGTCGGTCGGATCGACGCGCTCGAACGCGCGCGCCGCGACGAC
CTCGCGCGGCAGCGGCGCGCCGCGAACCGGCAGGACGACGACGCGGGCGGCGCGACGGCGATCGCGCGGG
CGGCGGCGTCCGTCGCGAATGCGCCGGGCGCCGCGCTGCCCCGCCGCATCGGCGTGTGTTGGGGGGACCC
GGCGCACGACAGGCCCGATGGCGACGGCGCGCAACCGTAA
 Primer design