SecReT6
Protein ID: 53723107
SecReT6 ID76
T6SS typei3
Gene symbol-
Locus tagBPSS2093
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]2831227..2833431 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ63II0
KEGG IDbps:BPSS2093
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-85, Aligned region: 23..325
Phage_GPD [PF05954], Evalue: 1.50E-85, Aligned region: 581..641
Phage_base_V [PF04717], Evalue: 1.00E-25, Aligned region: 364..456
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 510..525
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 516..539
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 530..547
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 556..579
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 581..603
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 646..664
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 715..727
Protein Sequence: 734 a.a.     [Download]
>gi|53723107|ref|YP_112092.1| unnamed protein product [Burkholderia pseudomallei K96243]
MTRVFTLDSLHGDDLKFHRLYGEEALGRMFDFRIEALADNHSLSLKELLGKPVTVRIRQQDESERHLNGI
VARAALVGRRAERHYGYQLIVRPWLWLATRRSDCRIFQNKTVPEIVQDVLGTYGFPIENHLTDTYAPRDY
CVQYNETDAAFVSRLMEFEGIYYYFKHAAQTHTLMLCDAMASHVALPGYEHIPFIARDRTAIADEEHIDS
WLPAQEVSIGKHETSDYDYTKPRADLSAQKIDPRGHDHDGFASFEWPGGYRDDEPGAHYSRVRLEEQQAE
HERALARTDVRGIAPGYLFTLEHCPRADQNREYLIVRCQYRFQENAYATDSGNEAVVHESQTLVQPSSLP
YRSPRATPRPRTNGPQTATVVGPKGEEIWTDQYGRVKLQFRWDRYGQSDQNSSCWVRVSSPWAGGGFGGV
QIPRIGDEVVVDFLNGDPDQPIVTGRVYNGEKMPPWGLPGSATQSGLLSRSSPGGTAEHSNAFRFEDKKG
AEQLWMHAERNFDAETEQDHTLSVGHDHSHSVGNNEMMSVANDRQRSVGQNETVNIGKHRVAQIGGNETH
GVAGNRTRQVGQNEAVTIGANREATIGGNHVETVAKDKTETIGQGKTLNVTQHYQTTSKSMKTAVAEHHA
EEIGSRTSTIEKAHELNVGGSQSVNVGASHTMSVKNNVHVGAGDQISLVCGDASITLKKDGTIAINGVTV
ESSASGSHSVRGKTVTSSATGEHTVEGTILKLNP
 
Nucleotide Sequence: 2205 bp     [Download]
>gi|53721039|ref|NC_006351.1|:c2833431-2831227 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
GTGACCCGCGTGTTCACACTCGACAGCCTGCACGGCGACGACCTGAAGTTCCACCGGCTCTACGGCGAGG
AAGCGCTCGGGCGGATGTTCGACTTCCGGATCGAAGCGCTCGCCGACAATCACAGCCTGTCGCTGAAGGA
ACTGCTCGGCAAGCCGGTGACGGTGCGCATCCGGCAGCAGGACGAATCGGAGCGCCATCTGAACGGGATC
GTCGCGCGCGCCGCGCTGGTCGGGCGGCGCGCGGAGCGGCATTACGGCTATCAACTGATCGTGCGGCCGT
GGCTGTGGCTCGCGACGCGCCGCTCCGATTGCCGGATCTTCCAGAACAAGACGGTGCCGGAAATCGTGCA
GGACGTGCTCGGCACGTACGGCTTTCCGATCGAAAACCATCTGACCGACACGTACGCGCCGCGCGACTAC
TGCGTGCAGTACAACGAGACCGACGCGGCGTTCGTGTCGCGGCTGATGGAGTTCGAAGGGATCTACTACT
ACTTCAAGCACGCCGCGCAAACGCACACGCTGATGCTGTGCGACGCGATGGCGTCGCACGTCGCGCTGCC
GGGCTACGAGCACATTCCGTTCATCGCGCGCGACCGCACCGCGATCGCCGACGAAGAGCACATCGACAGC
TGGCTGCCCGCGCAGGAAGTGAGCATCGGCAAGCACGAGACGAGCGACTACGACTACACGAAGCCGCGCG
CGGATCTGTCCGCGCAGAAGATCGATCCGCGCGGCCACGACCATGACGGCTTCGCGTCGTTCGAATGGCC
CGGCGGCTATCGCGACGATGAACCGGGCGCGCATTACAGCCGCGTGCGGCTCGAAGAGCAGCAGGCGGAG
CACGAACGCGCGCTCGCGCGCACCGACGTGCGCGGCATCGCACCCGGCTATCTGTTCACGCTCGAACACT
GCCCGCGCGCCGACCAGAACCGCGAATACCTGATCGTGCGCTGCCAGTATCGGTTTCAGGAGAACGCGTA
CGCGACCGATAGCGGCAACGAGGCGGTCGTGCACGAATCTCAGACACTCGTGCAGCCTTCGAGCTTGCCG
TATCGCTCGCCGCGCGCGACGCCGCGGCCGCGCACGAACGGCCCGCAGACGGCGACCGTCGTCGGCCCGA
AGGGCGAGGAAATCTGGACGGACCAGTACGGGCGCGTGAAGCTGCAATTTCGCTGGGACCGCTACGGGCA
GAGCGACCAGAACTCGTCGTGCTGGGTGCGCGTGTCGAGCCCGTGGGCGGGCGGCGGCTTCGGCGGCGTG
CAGATCCCGCGCATCGGCGATGAGGTGGTGGTCGATTTCCTGAACGGCGACCCCGATCAGCCGATCGTGA
CGGGGCGCGTGTACAACGGCGAGAAGATGCCGCCATGGGGGCTGCCCGGCAGCGCGACACAAAGCGGGCT
GCTGTCGCGCTCGTCGCCGGGCGGCACGGCCGAGCATTCGAACGCGTTTCGCTTCGAGGACAAGAAGGGC
GCGGAGCAGCTGTGGATGCATGCGGAGCGCAACTTCGACGCGGAGACTGAGCAGGACCACACGCTGTCGG
TGGGCCACGATCATTCGCATTCGGTCGGCAACAACGAGATGATGAGCGTCGCGAACGACCGGCAAAGGAG
CGTCGGGCAGAACGAGACGGTGAACATCGGGAAACATCGCGTCGCGCAGATCGGCGGGAACGAGACGCAT
GGCGTCGCGGGAAACCGCACGCGGCAGGTCGGACAGAACGAAGCCGTGACGATCGGCGCGAATCGCGAGG
CGACGATCGGCGGCAATCACGTGGAGACGGTCGCGAAAGACAAGACCGAAACGATTGGGCAGGGCAAGAC
GCTGAATGTCACTCAGCACTATCAGACGACTTCGAAGAGCATGAAGACCGCTGTCGCCGAACATCACGCC
GAGGAGATCGGCTCGCGAACGTCGACGATCGAGAAAGCGCACGAGCTCAACGTTGGCGGTTCTCAATCGG
TGAACGTTGGCGCGAGCCACACGATGAGCGTGAAGAACAACGTACATGTCGGCGCGGGCGATCAGATCTC
GCTCGTTTGCGGCGATGCGAGCATCACGCTGAAGAAGGACGGCACGATAGCGATCAACGGCGTCACGGTG
GAATCGAGCGCCAGCGGAAGCCATAGCGTGCGCGGCAAGACAGTGACGTCGTCGGCGACGGGCGAGCACA
CGGTGGAAGGCACGATACTGAAACTGAACCCCTGA
 Primer design