SecReT6
Protein ID: 53723108
SecReT6 ID76
T6SS typei3
Gene symbol-
Locus tagBPSS2094
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]2833428..2836094 [-]
ProductClp protease ATPase
NoteTssH
UniProt IDQ63IH9
KEGG IDbps:BPSS2094
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.50E-39, Aligned region: 229..248
AAA_2 [PF07724], Evalue: 3.50E-39, Aligned region: 616..782
AAA [PF00004], Evalue: 2.50E-19, Aligned region: 230..333
AAA [PF00004], Evalue: 2.50E-19, Aligned region: 621..705
ClpB_D2-small [PF10431], Evalue: 4.40E-13, Aligned region: 213..224
ClpB_D2-small [PF10431], Evalue: 4.40E-13, Aligned region: 788..862
AAA_5 [PF07728], Evalue: 4.40E-12, Aligned region: 230..249
AAA_5 [PF07728], Evalue: 4.40E-12, Aligned region: 620..738
AAA_22 [PF13401], Evalue: 2.00E-09, Aligned region: 230..310
AAA_22 [PF13401], Evalue: 2.00E-09, Aligned region: 370..396
AAA_22 [PF13401], Evalue: 2.00E-09, Aligned region: 516..547
AAA_22 [PF13401], Evalue: 2.00E-09, Aligned region: 617..646
AAA_22 [PF13401], Evalue: 2.00E-09, Aligned region: 681..703
AAA_16 [PF13191], Evalue: 1.60E-08, Aligned region: 37..58
AAA_16 [PF13191], Evalue: 1.60E-08, Aligned region: 102..162
AAA_16 [PF13191], Evalue: 1.60E-08, Aligned region: 207..246
AAA_16 [PF13191], Evalue: 1.60E-08, Aligned region: 274..309
AAA_16 [PF13191], Evalue: 1.60E-08, Aligned region: 376..396
AAA_16 [PF13191], Evalue: 1.60E-08, Aligned region: 442..546
AAA_16 [PF13191], Evalue: 1.60E-08, Aligned region: 615..664
AAA_16 [PF13191], Evalue: 1.60E-08, Aligned region: 685..703
Sigma54_activat [PF00158], Evalue: 8.30E-07, Aligned region: 225..245
Sigma54_activat [PF00158], Evalue: 8.30E-07, Aligned region: 603..728
IstB_IS21 [PF01695], Evalue: 2.50E-06, Aligned region: 224..251
IstB_IS21 [PF01695], Evalue: 2.50E-06, Aligned region: 619..640
IstB_IS21 [PF01695], Evalue: 2.50E-06, Aligned region: 730..751
AAA_19 [PF13245], Evalue: 1.60E-05, Aligned region: 227..251
AAA_19 [PF13245], Evalue: 1.60E-05, Aligned region: 383..405
AAA_19 [PF13245], Evalue: 1.60E-05, Aligned region: 614..642
AAA_17 [PF13207], Evalue: 4.10E-05, Aligned region: 231..247
AAA_17 [PF13207], Evalue: 4.10E-05, Aligned region: 373..402
AAA_17 [PF13207], Evalue: 4.10E-05, Aligned region: 619..656
AAA_25 [PF13481], Evalue: 6.20E-05, Aligned region: 228..254
AAA_25 [PF13481], Evalue: 6.20E-05, Aligned region: 286..319
AAA_25 [PF13481], Evalue: 6.20E-05, Aligned region: 518..539
AAA_25 [PF13481], Evalue: 6.20E-05, Aligned region: 595..644
AAA_25 [PF13481], Evalue: 6.20E-05, Aligned region: 793..829
RuvB_N [PF05496], Evalue: 6.40E-05, Aligned region: 229..245
RuvB_N [PF05496], Evalue: 6.40E-05, Aligned region: 300..310
RuvB_N [PF05496], Evalue: 6.40E-05, Aligned region: 582..641
RuvB_N [PF05496], Evalue: 6.40E-05, Aligned region: 689..818
Zeta_toxin [PF06414], Evalue: 8.30E-05, Aligned region: 230..247
Zeta_toxin [PF06414], Evalue: 8.30E-05, Aligned region: 619..660
AAA_18 [PF13238], Evalue: 0.0001, Aligned region: 231..249
AAA_18 [PF13238], Evalue: 0.0001, Aligned region: 621..649
AAA_14 [PF13173], Evalue: 0.00029, Aligned region: 287..310
AAA_14 [PF13173], Evalue: 0.00029, Aligned region: 618..737
AAA_29 [PF13555], Evalue: 0.00029, Aligned region: 220..243
AAA_29 [PF13555], Evalue: 0.00029, Aligned region: 615..646
Hpr_kinase_C [PF07475], Evalue: 0.005, Aligned region: 230..243
Hpr_kinase_C [PF07475], Evalue: 0.005, Aligned region: 621..638
ResIII [PF04851], Evalue: 0.0056, Aligned region: 221..249
ResIII [PF04851], Evalue: 0.0056, Aligned region: 287..312
ResIII [PF04851], Evalue: 0.0056, Aligned region: 592..641
Arch_ATPase [PF01637], Evalue: 0.0061, Aligned region: 127..154
Arch_ATPase [PF01637], Evalue: 0.0061, Aligned region: 208..243
Arch_ATPase [PF01637], Evalue: 0.0061, Aligned region: 286..314
Arch_ATPase [PF01637], Evalue: 0.0061, Aligned region: 618..641
NACHT [PF05729], Evalue: 0.0092, Aligned region: 230..256
NACHT [PF05729], Evalue: 0.0092, Aligned region: 291..333
NACHT [PF05729], Evalue: 0.0092, Aligned region: 621..646
Protein Sequence: 888 a.a.     [Download]
>gi|53723108|ref|YP_112093.1| unnamed protein product [Burkholderia pseudomallei K96243]
MSDIGRVTLFGKLNTFLYETLEQATGFCRLRGNPYVELAHWLNQMLRRPDSDVHRILRRFDIDAAAIDRG
IVSALDRLPRGAGSVSDLSAHIDDAVERAWVYATLKYDAAQIRGAVLLLALVKTPQLRNVLYAIARDFER
IVPDVLADELERIVAGSPEAPSPAARAAAGAIGDAGAAPSAAREGSALARYAIDLTARARAGEIDPVVGR
DGEIRQIVDILLRRRQNNPLLVGEAGVGKTAVAEGFALRIVAGDVPPPLRDVELYLLDIGLLQAGASVKG
EFESRLRGVIDEASSSERPVILFIDEVHTLVGAGGAAGTGDAANLLKPALARGVLRTIGATTWSEYKQYI
EKDPALTRRFQLVQVREPEEGAALAMLRGLAAKLEAHHRVLVLDDALQAAVTLSHRYVPARQLPDKAISL
LDTACARVAVSQHAVPAPIEDVRRRIDSLRVERELIARECALGAGDAQRLDAIDASIAGEQTTLDALDAR
WQAERDALGKIVDWRASLLADDSSRVLDEAARADVQAKLSAALRALAELQGETPLVLPAVDTHAVAAVVS
DWTGIPLGRMVRDEMQSVLKLAETLAERVVGQPHAVELIAERIQTARARLDDPAKPHGVFLLCGPSGVGK
TETALALAEMLYGGEHNAITINMSEFQEAHTVSTLKGAPPGYVGYGQGGVLTEAVRRRPYSVVLLDEIEK
AHRDVHEIFFQVFDKGWMEDGEGRYIDFRNTVILLTSNVGSERVMQLCRDPQRLPDAQTLTDALRAPLRE
VFPAALLGRLTVVPYYPLTDEMLARIVALQLARIERRIEAHHGIALRCADSATALIAERCRTIESGGRMV
DAILTHTVLPRISQEILRATIEGRALRAIDVSAEDGQFVYRFEEEGAT
 
Nucleotide Sequence: 2667 bp     [Download]
>gi|53721039|ref|NC_006351.1|:c2836094-2833428 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGTCCGATATCGGCCGAGTGACCTTGTTTGGAAAACTGAACACTTTTCTCTACGAGACCCTGGAGCAGG
CGACCGGCTTTTGTCGGCTGCGCGGCAATCCCTATGTCGAGCTCGCGCACTGGCTGAACCAGATGCTCCG
GCGCCCGGACAGCGACGTGCACCGGATCCTGCGCCGCTTCGACATCGACGCGGCGGCGATCGACCGCGGG
ATCGTTTCGGCGCTCGACCGGCTGCCGCGCGGCGCGGGTTCCGTGTCCGATCTGTCCGCGCACATCGATG
ATGCGGTCGAACGCGCATGGGTGTACGCGACGCTCAAGTACGACGCGGCGCAGATTCGCGGCGCGGTGCT
GCTGCTCGCGCTCGTGAAGACGCCGCAGCTGCGCAACGTGCTGTACGCGATCGCGCGGGACTTCGAGCGC
ATCGTGCCTGACGTGCTTGCCGACGAGCTCGAACGGATCGTCGCAGGCTCGCCGGAGGCGCCGTCGCCCG
CCGCGCGCGCGGCGGCGGGGGCGATCGGCGACGCGGGGGCGGCGCCGTCCGCCGCGCGCGAAGGCTCGGC
GCTCGCGCGCTACGCGATCGATCTGACCGCGCGTGCGCGCGCGGGCGAGATCGATCCGGTGGTCGGCCGC
GACGGCGAGATTCGGCAGATCGTCGACATCCTGCTGCGCCGCCGGCAGAACAATCCGCTGCTCGTCGGCG
AGGCGGGCGTCGGCAAGACCGCGGTCGCCGAAGGCTTCGCGCTGCGCATCGTCGCGGGCGACGTGCCGCC
GCCGCTGCGCGACGTCGAACTGTATCTGCTCGACATCGGCCTGCTGCAGGCGGGCGCGAGCGTGAAGGGC
GAATTCGAGAGCCGCCTGCGCGGCGTGATCGACGAGGCGAGTTCGAGCGAGCGGCCCGTCATTCTGTTCA
TCGACGAGGTACACACGCTCGTCGGCGCGGGCGGCGCGGCGGGCACGGGCGACGCGGCGAACCTGTTGAA
GCCCGCGCTCGCGCGCGGCGTGCTGCGCACGATCGGCGCGACGACGTGGTCCGAATACAAGCAATACATC
GAGAAGGACCCGGCGCTCACGCGGCGCTTCCAGCTCGTGCAGGTGCGCGAGCCGGAGGAGGGCGCGGCGC
TGGCGATGCTGCGCGGGCTCGCCGCGAAGCTGGAGGCGCACCATCGCGTGCTCGTGCTCGACGATGCGCT
GCAGGCGGCCGTCACGCTGTCGCATCGCTACGTTCCCGCGCGGCAGTTGCCGGACAAGGCGATCAGCCTG
CTCGACACCGCGTGCGCGCGCGTCGCGGTCAGCCAGCACGCGGTGCCCGCGCCGATCGAGGACGTGCGGC
GGCGGATCGATAGCCTGCGCGTCGAGCGCGAGCTGATCGCGCGCGAGTGCGCGCTCGGCGCGGGCGATGC
GCAACGGCTCGATGCAATCGATGCATCGATCGCCGGCGAACAGACCACGCTCGATGCGCTCGACGCGCGC
TGGCAGGCGGAGCGCGACGCGCTCGGCAAGATCGTCGACTGGCGGGCCTCGCTGCTGGCCGACGATTCTT
CGCGCGTGCTCGATGAGGCGGCGCGCGCGGACGTGCAGGCGAAGCTCTCGGCCGCGCTGCGCGCGCTCGC
CGAATTGCAGGGCGAGACGCCGCTCGTGCTGCCCGCGGTCGATACGCACGCGGTGGCCGCCGTGGTGTCC
GACTGGACCGGCATCCCGCTCGGGCGGATGGTGCGCGACGAGATGCAATCGGTGCTGAAGCTCGCCGAGA
CGCTCGCCGAGCGCGTGGTCGGCCAGCCGCACGCGGTCGAGCTGATCGCCGAGCGCATTCAGACCGCGCG
CGCGCGGCTCGACGATCCGGCCAAGCCGCACGGCGTGTTCCTGCTGTGCGGGCCGTCCGGCGTCGGCAAG
ACCGAGACGGCGCTCGCGCTCGCCGAGATGCTGTACGGCGGCGAGCACAACGCGATCACGATCAACATGA
GCGAGTTTCAGGAGGCGCACACCGTATCGACGCTCAAGGGCGCGCCGCCCGGCTACGTCGGCTACGGACA
GGGCGGGGTGCTGACCGAGGCGGTGCGGCGGCGGCCGTACAGTGTCGTGCTGCTCGACGAAATCGAGAAG
GCGCACCGCGACGTGCACGAGATCTTCTTTCAGGTGTTCGACAAGGGCTGGATGGAAGACGGCGAGGGGC
GCTATATCGACTTTCGCAACACGGTGATCCTCCTCACGTCGAACGTCGGTTCCGAGCGCGTGATGCAGCT
GTGCCGCGATCCGCAGCGCCTGCCCGATGCGCAGACCTTGACCGATGCGCTGCGCGCGCCGCTGCGCGAG
GTGTTTCCCGCCGCGTTGTTGGGACGCCTGACGGTCGTTCCGTACTACCCGCTCACCGACGAGATGCTCG
CGCGGATCGTCGCATTGCAGCTCGCGCGCATCGAGCGGCGCATCGAAGCGCACCACGGCATCGCGTTGCG
CTGCGCGGATTCGGCGACCGCGCTGATCGCCGAGCGCTGCCGGACGATCGAATCCGGCGGCCGCATGGTC
GACGCGATTCTCACGCACACGGTGCTGCCGCGCATCAGCCAGGAGATCCTGCGCGCGACGATCGAGGGGC
GCGCGCTGCGGGCGATCGACGTGAGCGCCGAAGACGGCCAGTTCGTTTACCGATTCGAAGAGGAGGGCGC
GACGTGA
 Primer design