SecReT6
Protein ID: 53723111
SecReT6 ID76
T6SS typei3
Gene symbol-
Locus tagBPSS2097
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]2839424..2839960 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ63IH6
KEGG IDbps:BPSS2097
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.80E-22, Aligned region: 42..156
Protein Sequence: 178 a.a.     [Download]
>gi|53723111|ref|YP_112096.1| unnamed protein product [Burkholderia pseudomallei K96243]
MRAAGGVRAAHDRLQPALLDRLTDAERERRTEPPDAQAIGGERLRAAVLRDLAWLLNTRNGEDGFVDWSA
FAHAQASVLNYGMRPLVGKPMSGVERMSVEASIRDAIVRFEPRIAPDSVEVRSVLDAPGGAAGERRHNVL
MFEIKGTLWSIPHPVEFVLRSDLDLETGAMALHPAAGG
 
Nucleotide Sequence: 537 bp     [Download]
>gi|53721039|ref|NC_006351.1|:c2839960-2839424 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
GTGCGAGCCGCGGGCGGCGTGCGCGCCGCGCATGACCGGCTGCAGCCGGCGCTGCTCGACCGGCTGACCG
ACGCCGAGCGCGAGCGGCGCACCGAGCCGCCCGACGCGCAGGCGATCGGCGGCGAGCGCCTGCGCGCGGC
GGTGCTGCGCGATCTGGCGTGGCTGCTCAACACGCGCAACGGCGAGGACGGCTTCGTCGACTGGTCGGCG
TTCGCGCACGCGCAGGCGTCGGTGCTCAACTACGGGATGCGGCCGCTCGTCGGCAAGCCGATGTCGGGCG
TCGAGCGGATGTCGGTCGAGGCGTCGATCCGCGATGCGATCGTGCGTTTCGAGCCGCGTATCGCGCCCGA
CAGCGTCGAGGTGCGCAGCGTGCTCGACGCGCCGGGCGGCGCGGCGGGCGAGCGCCGGCACAACGTGCTG
ATGTTCGAGATCAAGGGCACGCTGTGGTCGATTCCGCATCCGGTCGAGTTCGTGCTGCGCTCGGACCTCG
ATCTGGAGACGGGCGCGATGGCGCTGCACCCGGCGGCGGGAGGCTGA
 Primer design