SecReT6
Protein ID: 53723112
SecReT6 ID76
T6SS typei3
Gene symbol-
Locus tagBPSS2098
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]2839991..2840482 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ63IH5
KEGG IDbps:BPSS2098
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.80E-34, Aligned region: 6..138
Protein Sequence: 163 a.a.     [Download]
>gi|53723112|ref|YP_112097.1| unnamed protein product [Burkholderia pseudomallei K96243]
MGVAMFMKVDGVTGESADAQHKGWTDIQSFSWGASQPGAMASGSGGNAGKASFNDLVVAAYMDKGATAII
KNCASGKHLPTVEISACKTGGSQIEFMRVTLQEVLVTSAQIAGVDPGDAADRLMMQYGFQAAKVKKQYWQ
QNDNGGKGAEVSVGWNIKENTEM
 
Nucleotide Sequence: 492 bp     [Download]
>gi|53721039|ref|NC_006351.1|:c2840482-2839991 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGGGCGTCGCAATGTTTATGAAAGTGGACGGCGTCACCGGCGAATCGGCCGACGCGCAGCACAAGGGCT
GGACCGACATCCAGTCGTTCTCATGGGGCGCGAGCCAGCCGGGCGCGATGGCGAGCGGCAGCGGCGGCAA
CGCGGGCAAGGCGAGCTTCAACGATCTCGTCGTCGCCGCGTACATGGACAAGGGCGCAACGGCGATCATC
AAGAACTGCGCGAGCGGCAAGCACCTGCCGACGGTCGAGATATCGGCGTGCAAGACGGGCGGCTCGCAGA
TCGAGTTCATGCGCGTGACGCTGCAGGAAGTGCTCGTCACGTCCGCGCAGATCGCGGGCGTGGACCCGGG
CGACGCGGCCGACCGGCTGATGATGCAGTACGGTTTTCAGGCCGCGAAGGTCAAGAAGCAGTACTGGCAG
CAGAACGACAACGGCGGCAAGGGCGCCGAAGTGTCGGTCGGCTGGAACATCAAGGAGAACACCGAGATGT
GA
 Primer design