SecReT6
Protein ID: 53723114
SecReT6 ID76
T6SS typei3
Gene symbol-
Locus tagBPSS2100
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]2842043..2842621 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ63IH3
KEGG IDbps:BPSS2100
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.00E-58, Aligned region: 15..166
Protein Sequence: 192 a.a.     [Download]
>gi|53723114|ref|YP_112099.1| unnamed protein product [Burkholderia pseudomallei K96243]
MTSKYKASASGQKFIARNRAPRVQIEYDVETYGAERKVQLPFVMGVIADLAGKRAEPLPDLPERKFLEID
VDNFDERMKSIAPRVAFQVPNTLSGDGMLSVDMTFESIDDFSPAAIARNVDALRRLLDARTELSNLLSYM
DGKHGAEQLIENAINDPALLASLVRQPLAADAEGGARQPVTGTEDDPEIRHE
 
Nucleotide Sequence: 579 bp     [Download]
>gi|53721039|ref|NC_006351.1|:c2842621-2842043 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGACGAGCAAGTACAAGGCTTCGGCCAGCGGACAGAAATTCATCGCGCGCAACCGCGCGCCGCGCGTGC
AGATCGAGTACGACGTCGAGACCTACGGCGCCGAGCGCAAGGTCCAACTGCCGTTCGTGATGGGCGTGAT
CGCGGATCTCGCGGGCAAGCGGGCCGAGCCGCTGCCGGACTTGCCGGAGCGCAAGTTCCTCGAAATCGAC
GTCGACAATTTCGACGAGCGGATGAAATCGATCGCGCCGCGCGTCGCGTTCCAGGTGCCGAACACGCTGT
CGGGAGACGGCATGCTGAGCGTCGACATGACGTTCGAGAGCATCGACGATTTCTCGCCCGCCGCGATCGC
GCGCAACGTCGACGCGTTGCGGCGCCTGCTCGACGCGCGCACCGAGCTGTCGAACCTGCTGTCGTACATG
GACGGCAAGCACGGCGCCGAGCAACTGATCGAAAACGCGATCAACGATCCGGCACTGCTGGCCTCGCTCG
TGCGGCAGCCGCTCGCGGCGGACGCCGAAGGCGGCGCGCGGCAGCCCGTGACCGGCACCGAAGACGACCC
GGAGATTCGCCATGAATGA
 Primer design