SecReT6
Protein ID: 53723118
SecReT6 ID76
T6SS typei3
Gene symbol-
Locus tagBPSS2104
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]2847580..2851209 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ63IG9
KEGG IDbps:BPSS2104
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.30E-96, Aligned region: 213..478
ImcF-related_N [PF14331], Evalue: 1.30E-96, Aligned region: 1062..1079
IcmF-related [PF06761], Evalue: 1.20E-95, Aligned region: 370..390
IcmF-related [PF06761], Evalue: 1.20E-95, Aligned region: 526..836
DUF1215 [PF06744], Evalue: 9.40E-34, Aligned region: 65..87
DUF1215 [PF06744], Evalue: 9.40E-34, Aligned region: 945..1069
Protein Sequence: 1209 a.a.     [Download]
>gi|53723118|ref|YP_112103.1| unnamed protein product [Burkholderia pseudomallei K96243]
MSHAVARIVRPLPSRDIWTFAGLVVLACFVWLAGPLFAFAEFRPFESGAVRAATIVALFVAWGARIAWRG
WRAGQLNAQLLNQLREAAPRPAATGDPAQAQLDELRSRFDEAATLLKKVRFGEADGARKGLPRWLEQMSR
QYLYQLPWYVFIGAPGSGKTTALVNSGLSFPLAEQFGRAAIRGVGGTRHCDWWFTNDAVLIDTAGRYTTH
ESNRALDEAEWKGFVDLLKKYRARQPLNGAMLTISVADLLGASEAERTQHAMVLRKRLLELRAQLGIRFP
VYLLVTKADLLAGFAEYFGGFGRAECAQVWGFTFPLAESEAPGFELRAAFDREYRLLHQRLNDGLPELLA
SQTDARQREMTYLLPQQIADLQDMLGQFVAEVFSVSSFEPMPMLRGVYLTSGTQEGTAFDRVMSGIKRFL
KIEGVPPAAQTGSSGRSFFLKSLLQDHIFREAALAGSNLRWHQRQRALQIVGYAAIALLCVAVLFAWLRS
YSRNRDYLDEVAARVPAVDAQIGRAKFTGAADIVQLLPVLDELSGLPNAGGVDLRHPPLAYRWGLFQGEK
IEEASDAVYRRALDDVLLPIAASRMEQALRDARPDEVEYAYAALKAYLMLYDSAHYDPAFVQAVVDLEME
RALPADFSSAQRSALRAHLGALFGNRVAVSPFPMNERLVADVRERLRQVPFSQRLYRQLARTLHASTASY
DFSVARAVGPDASLVFRRQSGKSLADGVPGLYTRSGYRNVFAPRLPGAIDSYGREEVWVLNLGASEIPNP
ADAAAWARDIRQLYLNDYIKTWDDYLADIRLQRTSTLAQSIQVARTLSSADSPLTRLMVALARDTPLGDA
PGGARNLASRAQDKVDEARNSLAQIFAGQPGGEAGAAAAPPASPEQIVDSHFAGLRAFAPGGGDQAASFD
AVLKAIDALYTYLTATDDALRSGAAPPPSDAPARLRAQAGRLPTPVREVLDDLSNVANGSIASVEQRNVA
QRAGANVGDFCRQAIAGRYPFARGAARDVAPSDFAQLFAAGGLMDDFFQKNLQTLVDTTAHPWRFNNRNA
EADPSAAAMLGSFEKAAVIRDVYFGGGARTAQIKVEIVPLEMDPSISEMLLDVDGQIVRYAHGPQVPTAV
QWPGTRGSNQVRLQVTEQSGATGGFTTEGPWALHRLFDRAGVSGGRGPEQMVARFAVDGKPIVLQVTASS
VRNPFRLPQMESFTCPPKQ
 
Nucleotide Sequence: 3630 bp     [Download]
>gi|53721039|ref|NC_006351.1|:c2851209-2847580 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGAGCCACGCTGTCGCACGCATCGTTCGCCCGCTGCCGTCGCGGGACATCTGGACGTTCGCCGGCCTCG
TCGTGCTGGCGTGTTTCGTTTGGCTTGCCGGGCCGCTGTTCGCGTTCGCCGAGTTCCGCCCGTTCGAGAG
CGGCGCGGTGCGCGCGGCGACGATCGTCGCGCTGTTCGTCGCGTGGGGCGCGCGGATCGCGTGGCGCGGC
TGGCGCGCGGGGCAACTGAACGCGCAGTTGCTCAACCAGTTGCGCGAAGCGGCGCCGCGGCCCGCCGCGA
CGGGCGATCCCGCGCAGGCGCAGCTCGACGAGCTGCGCAGCCGCTTCGACGAAGCCGCGACGCTGTTGAA
GAAAGTCCGTTTCGGCGAAGCCGACGGCGCGCGCAAGGGCCTGCCGCGGTGGCTCGAGCAGATGTCGCGC
CAGTATCTGTACCAACTGCCGTGGTACGTGTTCATCGGCGCGCCGGGCTCGGGCAAGACGACGGCGCTCG
TCAACTCGGGGCTGAGCTTTCCGCTCGCCGAGCAGTTCGGGCGCGCGGCGATTCGCGGCGTCGGCGGCAC
GCGGCACTGCGACTGGTGGTTCACGAACGACGCGGTGCTGATCGACACCGCGGGCCGCTACACGACGCAC
GAGAGCAACCGCGCGCTCGACGAGGCCGAATGGAAGGGCTTCGTCGATCTGCTGAAGAAGTACCGCGCGC
GCCAGCCGCTGAACGGCGCGATGCTGACGATCAGCGTCGCCGATCTGCTCGGCGCGTCGGAGGCGGAGCG
CACGCAGCACGCGATGGTGCTGCGCAAGCGCCTGCTCGAGCTGCGCGCGCAGCTCGGCATCCGCTTTCCG
GTGTATCTGCTCGTGACGAAGGCGGATTTGCTCGCCGGCTTCGCCGAATACTTCGGCGGCTTCGGCCGCG
CCGAATGCGCGCAGGTGTGGGGCTTCACGTTCCCGCTCGCCGAGAGCGAAGCGCCCGGCTTCGAGCTGCG
CGCGGCGTTCGACCGCGAATACCGGCTGCTGCACCAGCGGCTGAACGACGGGCTGCCGGAGCTGCTCGCA
TCGCAGACCGACGCGCGCCAGCGCGAGATGACCTACCTGCTGCCGCAGCAGATCGCCGATCTGCAGGACA
TGCTCGGCCAGTTCGTCGCCGAGGTGTTCTCGGTGTCGAGCTTCGAGCCGATGCCGATGCTGCGCGGCGT
CTATCTGACGAGCGGCACGCAGGAAGGCACCGCGTTCGACCGCGTGATGAGCGGGATCAAGCGCTTCCTG
AAGATCGAGGGCGTGCCGCCCGCCGCGCAGACGGGCTCGTCGGGCCGCAGTTTCTTCCTGAAATCGCTGC
TGCAGGATCACATCTTTCGCGAGGCGGCGCTTGCCGGCAGCAATCTGCGCTGGCATCAGCGGCAGCGTGC
GCTGCAGATCGTCGGCTACGCGGCGATCGCGCTGCTGTGCGTGGCGGTGCTGTTCGCGTGGCTGCGCAGC
TACTCGCGCAATCGCGACTATCTCGACGAGGTCGCCGCGCGCGTGCCGGCGGTCGACGCGCAGATCGGCC
GCGCGAAATTCACGGGCGCGGCCGACATCGTGCAGCTGCTGCCGGTGCTCGACGAGCTGAGCGGCCTGCC
GAACGCGGGCGGCGTGGACTTGCGGCATCCGCCGCTCGCGTATCGCTGGGGCCTGTTCCAGGGCGAGAAG
ATCGAGGAGGCGAGCGACGCCGTCTACCGGCGCGCGCTCGACGACGTGCTGCTGCCGATCGCCGCGAGCC
GGATGGAGCAGGCGCTGCGCGACGCGCGGCCCGACGAGGTCGAGTATGCGTACGCGGCGCTCAAGGCGTA
CCTGATGCTTTACGACAGCGCGCACTACGATCCCGCGTTCGTGCAGGCCGTCGTCGATCTCGAGATGGAG
CGCGCGCTGCCGGCCGATTTCTCGTCCGCGCAGCGCAGCGCGCTGCGCGCGCATCTCGGCGCGCTGTTCG
GCAATCGCGTCGCGGTGTCGCCGTTTCCGATGAACGAGCGGCTCGTCGCCGACGTGCGCGAGCGGCTGCG
GCAGGTGCCGTTCTCGCAGCGGCTGTATCGGCAGCTCGCGCGCACGCTGCACGCGAGCACCGCGTCGTAC
GATTTCAGCGTCGCGCGCGCGGTGGGGCCGGACGCGTCGCTCGTGTTCCGGCGGCAGAGCGGCAAGAGCC
TCGCCGACGGCGTGCCGGGCCTCTACACGCGCAGCGGCTACCGCAACGTGTTCGCGCCGCGTCTGCCCGG
CGCGATCGACTCGTACGGGCGCGAGGAGGTGTGGGTGCTGAACCTCGGCGCGTCCGAGATCCCGAATCCG
GCCGACGCGGCCGCCTGGGCGCGCGACATCCGGCAGCTCTACCTGAACGACTACATCAAGACCTGGGACG
ACTATCTGGCCGACATCCGGCTGCAGCGCACGTCGACGCTCGCGCAGAGCATCCAGGTCGCGCGCACGCT
GTCGTCGGCCGATTCGCCGCTCACGCGGCTGATGGTCGCGCTCGCGCGCGACACGCCGCTCGGCGATGCG
CCCGGCGGCGCGCGCAATCTCGCGTCGCGCGCGCAGGACAAGGTCGACGAGGCGCGCAACTCGCTCGCGC
AGATCTTCGCCGGGCAGCCGGGCGGCGAAGCGGGCGCGGCGGCCGCGCCGCCCGCGAGCCCCGAGCAGAT
CGTCGACAGCCACTTCGCGGGGCTGCGCGCGTTCGCGCCGGGCGGCGGGGATCAGGCGGCGTCGTTCGAC
GCGGTGCTCAAGGCGATCGACGCGCTGTACACGTACCTCACCGCGACCGACGACGCATTGCGCAGCGGCG
CGGCGCCGCCGCCGTCGGACGCGCCCGCGCGGCTGCGCGCGCAGGCGGGCCGGTTGCCGACGCCTGTGCG
CGAGGTGCTCGACGATTTGTCGAACGTCGCGAACGGCAGCATCGCGAGCGTCGAGCAGCGCAACGTCGCG
CAGCGCGCGGGCGCGAACGTCGGCGATTTCTGCCGGCAGGCGATCGCCGGGCGCTACCCGTTCGCGCGCG
GCGCGGCGCGCGACGTCGCGCCGTCCGATTTCGCGCAGCTGTTCGCGGCGGGCGGCCTGATGGACGACTT
CTTCCAGAAGAACCTGCAAACGCTCGTCGACACGACCGCGCATCCGTGGCGTTTCAACAACCGCAACGCC
GAAGCCGACCCGTCGGCGGCCGCGATGCTCGGCTCGTTCGAGAAGGCGGCGGTGATCCGCGACGTCTATT
TCGGAGGCGGCGCGCGGACCGCGCAGATCAAGGTCGAGATCGTGCCGCTCGAAATGGACCCGTCGATCTC
GGAGATGCTGCTCGACGTCGACGGCCAGATCGTCCGCTACGCGCACGGCCCGCAGGTGCCGACGGCGGTG
CAGTGGCCCGGCACGCGCGGCAGCAATCAGGTGCGGCTGCAGGTGACCGAGCAGTCGGGGGCGACGGGCG
GCTTCACGACCGAGGGCCCGTGGGCGCTGCACCGGCTGTTCGACCGCGCGGGCGTGTCGGGTGGGCGCGG
ACCCGAGCAGATGGTCGCGAGATTCGCGGTCGACGGCAAGCCGATCGTGCTGCAGGTGACGGCGAGCAGC
GTTCGCAACCCGTTCCGGTTGCCGCAGATGGAGTCCTTTACATGTCCTCCGAAGCAATGA
 Primer design