SecReT6
Protein ID: 53723120
SecReT6 ID76
T6SS typei3
Gene symbol-
Locus tagBPSS2106
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]2852544..2853932 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ63IG7
KEGG IDbps:BPSS2106
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.40E-159, Aligned region: 25..461
Protein Sequence: 462 a.a.     [Download]
>gi|53723120|ref|YP_112105.1| unnamed protein product [Burkholderia pseudomallei K96243]
MSATPAAALRQRVIWTEGMFLRPQHFQQLERHWERYVGMRCLPLQGFYWGYDELQIDRELLALGKVALLA
ATGVMRDGTPFDLSHPDDRPEPLDVPADAKDQLVVLALPLWRGGAQEVSFGAGGNGEGRGGDGNAHAGFA
RYVVREYEVADANEVALGPALLQTGRLNVRLMLESELTGDWQALGVARVVERRTDGRLLVDDGYIPPRLV
AQRDPVLLRHTRELHGLLTQRSEALGERLSEPGRGGVSEVADFLLLQLVNRYLALTWHAQQDVAAHPETL
FCDWLKLACDLSTFTAAGRRPQSLAVYRHDDLRASFGELMAELRRSLSTVLEQNAIQIELRDVGNGMKVA
TIADPALRDTAGFVLAVRADVPADSLRARFPAQAKLGPVERIRDLVQLQLPGIAMRQLPVAPRQIPYHAG
HTYFEIDKGGEMWKQLERSGGLAFHFAGEFPGLSMEFWAIRG
 
Nucleotide Sequence: 1389 bp     [Download]
>gi|53721039|ref|NC_006351.1|:c2853932-2852544 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
TTGTCCGCGACCCCCGCTGCGGCGTTGCGCCAGCGCGTGATCTGGACCGAGGGCATGTTCCTGCGGCCGC
AGCATTTCCAGCAGCTCGAGCGGCACTGGGAGCGCTACGTCGGCATGCGCTGCCTGCCGCTGCAAGGCTT
CTACTGGGGCTACGACGAGTTGCAGATCGATCGCGAGCTGCTCGCGCTCGGCAAGGTCGCGCTGCTCGCC
GCGACCGGCGTGATGCGCGACGGCACGCCGTTCGACCTGTCGCATCCGGACGACCGGCCCGAGCCGCTCG
ACGTGCCCGCCGACGCGAAGGATCAGCTCGTCGTGCTCGCGCTGCCGCTGTGGCGCGGCGGCGCGCAGGA
GGTGTCGTTCGGCGCGGGCGGCAACGGCGAAGGCCGCGGCGGCGACGGCAACGCGCACGCGGGCTTCGCG
CGCTACGTCGTGCGCGAATACGAAGTCGCCGACGCGAACGAGGTCGCGCTCGGCCCCGCGCTATTGCAGA
CCGGCCGCCTGAACGTGCGCCTGATGCTCGAATCCGAATTGACGGGCGACTGGCAGGCGCTCGGCGTCGC
GCGCGTCGTCGAGCGGCGCACCGATGGGCGGCTGCTCGTCGACGACGGCTACATTCCGCCGCGGCTCGTC
GCGCAGCGCGATCCGGTGCTGCTGCGCCACACGCGCGAGCTGCACGGGCTGCTCACGCAACGCAGCGAGG
CGCTCGGCGAGCGCCTGTCGGAGCCGGGGCGCGGCGGCGTGTCCGAAGTCGCCGATTTCCTGCTGCTGCA
ACTCGTCAACCGCTATCTGGCGCTCACGTGGCACGCGCAGCAGGATGTCGCCGCGCACCCGGAGACGCTG
TTCTGCGATTGGCTGAAGCTCGCGTGCGACCTGAGCACATTCACCGCGGCCGGCCGCCGGCCGCAGTCGC
TCGCGGTCTACCGGCACGACGATCTGCGCGCGAGCTTCGGCGAGCTGATGGCCGAGCTGCGCCGCTCATT
GTCGACGGTGCTCGAGCAGAACGCGATCCAGATCGAGCTGCGCGACGTGGGCAACGGCATGAAGGTCGCG
ACGATCGCCGATCCGGCGCTGCGCGACACGGCGGGCTTCGTGCTCGCCGTGCGCGCCGACGTGCCGGCCG
ACAGCCTGCGCGCGCGCTTTCCCGCGCAGGCGAAGCTCGGTCCCGTCGAGCGCATTCGCGATCTCGTGCA
GTTGCAACTGCCGGGCATCGCGATGCGGCAGTTGCCCGTCGCGCCGCGGCAGATTCCGTATCACGCGGGC
CACACGTACTTCGAGATCGACAAGGGCGGCGAGATGTGGAAACAGCTCGAACGCTCGGGCGGCCTCGCAT
TTCATTTCGCCGGCGAATTCCCGGGACTCTCGATGGAGTTCTGGGCGATTCGCGGGTGA
 Primer design