SecReT6
Protein ID: 53723121
SecReT6 ID76
T6SS typei3
Gene symbol-
Locus tagBPSS2107
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]2853944..2854462 [-]
Producthypothetical protein
NoteTssJ
UniProt IDQ63IG6
KEGG IDbps:BPSS2107
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.20E-38, Aligned region: 14..160
Protein Sequence: 172 a.a.     [Download]
>gi|53723121|ref|YP_112106.1| unnamed protein product [Burkholderia pseudomallei K96243]
MRPRFSVSVVLGCALLLAGCGATERSVAVPYSITLDVAPDVNPDLNRKPSPIVLKVFQLKTASAFESADF
FSLQDKPQSVLGADLLGVDRIILRPGDARTLHYRGNVDAGAIGIVAEYRVLEKNRWRMTVPLPRAKQLNL
YRFWQTSPGEMKLQVAVKNGGIGLGGDSRVRQ
 
Nucleotide Sequence: 519 bp     [Download]
>gi|53721039|ref|NC_006351.1|:c2854462-2853944 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGCGACCGCGGTTCAGTGTTTCCGTCGTTCTGGGATGCGCGCTGCTGCTCGCCGGATGCGGGGCGACCG
AGCGTTCCGTTGCGGTGCCGTATTCGATCACGCTCGACGTCGCGCCCGACGTCAATCCGGACCTCAATCG
CAAGCCGTCGCCGATCGTGCTGAAGGTGTTCCAGCTGAAGACGGCGTCCGCGTTCGAAAGCGCCGATTTC
TTCTCGCTGCAGGACAAGCCGCAGAGCGTGCTCGGCGCGGATCTGCTCGGCGTCGACCGGATCATCCTGC
GCCCGGGGGATGCGCGCACGCTGCACTATCGCGGCAACGTCGACGCGGGCGCGATCGGCATCGTCGCCGA
ATATCGCGTGCTCGAGAAGAACCGCTGGCGGATGACGGTGCCGCTGCCGCGCGCGAAGCAACTGAACCTG
TACCGATTCTGGCAAACCTCGCCGGGCGAGATGAAGCTGCAGGTCGCCGTGAAGAACGGCGGCATCGGCC
TCGGCGGCGATTCGCGAGTACGCCAATGA
 Primer design