SecReT6
Protein ID: 53723123
SecReT6 ID76
T6SS typei3
Gene symbol-
Locus tagBPSS2109
StrainBurkholderia pseudomallei K96243
Repliconchromosome II [GenBank: NC_006351] [Browse all T6SS(s) in this replicon]
Location [Strand]2855558..2856994 [+]
ProductFHA-family protein
NoteFha
UniProt IDQ63IG4
KEGG IDbps:BPSS2109
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 5.60E-10, Aligned region: 29..96
Protein Sequence: 478 a.a.     [Download]
>gi|53723123|ref|YP_112108.1| unnamed protein product [Burkholderia pseudomallei K96243]
MQLTVIEHAGEPVGTDGRNAVVFHAPGGTIGRDSDNHLVLRDDTRQISRLQALLQVADDACLLKNLSSVS
TIEVNRVPIGYAQAQRLNMGDIIRIGPYLLRAEPDDATIERTVEAAATGAAAAAPAASAAQAQAKGAGNK
LWGLLHERFGLGKAQGAGEQSGARAAPARHRDSPASAAPRDLNQLSTDPLDLFAQPHGDPDARAGAAREG
EDRAPPTVTQPDHAPEWTQHVRVQPAQSAPPAASRPGAPAARSGDIPGADDASDMPSRVRASPAPAPATP
ETLLQAFFEGAGLDTAAEQHHWSAEQLFVAGQLLALFANGTVELLSSRSILKREVKADMTMLLDRENNPL
KLLPDGSAVLRQMFGLPLPGFMTPQSAVSDAFQDLHAHQIGMVAGMRAALMDLLTRFSPQRLRERDAAPQ
WYEKRVPALYKARLWDRYAATHRDTLFAIEDDFASVFGKAFLSAYDAEVESYRGRCRR
 
Nucleotide Sequence: 1437 bp     [Download]
>gi|53721039|ref|NC_006351.1|:2855558-2856994 Burkholderia pseudomallei K96243 chromosome 2, complete sequence
ATGCAACTGACCGTTATCGAACACGCGGGCGAGCCGGTCGGCACCGACGGCCGCAACGCCGTCGTGTTTC
ATGCGCCGGGCGGCACCATCGGCCGGGACAGCGACAATCACCTCGTGCTGCGCGACGACACCCGGCAAAT
CTCGCGCCTGCAGGCGCTGCTGCAGGTGGCCGACGACGCGTGCCTGCTGAAGAACCTGAGCAGCGTATCG
ACGATCGAAGTGAACCGCGTGCCGATCGGCTACGCGCAGGCGCAGCGCCTGAACATGGGCGACATCATCC
GGATCGGCCCTTACCTGCTGCGCGCGGAGCCCGACGACGCGACGATCGAGCGAACCGTCGAAGCCGCCGC
CACGGGGGCCGCGGCGGCGGCGCCGGCGGCGTCCGCCGCGCAGGCTCAGGCGAAGGGGGCGGGCAACAAA
CTGTGGGGCCTGTTGCACGAGCGCTTCGGGCTCGGCAAGGCACAGGGCGCGGGCGAGCAGTCCGGCGCGC
GCGCCGCGCCGGCGCGCCACCGCGATTCGCCGGCGTCCGCCGCGCCGCGCGACCTGAATCAGCTGTCGAC
CGATCCGCTCGACCTGTTCGCGCAGCCGCACGGCGATCCGGATGCGCGAGCCGGCGCCGCGCGCGAAGGC
GAAGACCGCGCGCCGCCCACCGTCACGCAACCGGATCACGCGCCCGAGTGGACGCAACACGTCCGCGTGC
AGCCGGCACAATCCGCGCCGCCCGCCGCCTCTCGCCCCGGCGCGCCCGCCGCGCGTTCGGGCGATATCCC
CGGAGCGGACGATGCGAGCGACATGCCGTCGCGCGTGCGCGCGTCGCCGGCCCCCGCGCCGGCGACACCC
GAGACATTGCTGCAGGCGTTCTTCGAAGGCGCGGGGCTCGACACCGCCGCCGAGCAGCATCACTGGTCCG
CCGAGCAGTTGTTCGTCGCGGGGCAACTGCTCGCGCTGTTCGCCAACGGCACGGTCGAGCTGCTGTCGTC
ACGCAGCATCCTGAAGCGCGAAGTGAAGGCCGACATGACGATGCTGCTCGACCGCGAGAACAATCCGCTG
AAGCTGCTGCCGGACGGCAGCGCGGTGCTGCGCCAGATGTTCGGGCTGCCGCTGCCGGGCTTCATGACAC
CGCAAAGCGCCGTGTCCGACGCGTTCCAGGATCTGCACGCGCACCAGATCGGCATGGTGGCCGGCATGCG
CGCCGCGCTGATGGATCTGCTCACGCGCTTCTCGCCGCAGCGCCTGCGCGAGCGCGACGCCGCGCCCCAG
TGGTACGAGAAGCGCGTGCCGGCGCTGTACAAGGCGCGCCTCTGGGACCGCTATGCAGCCACGCATCGCG
ACACGCTGTTCGCGATCGAGGACGATTTCGCCTCCGTGTTCGGCAAGGCGTTCCTCAGCGCCTACGACGC
GGAAGTCGAGAGCTATCGCGGACGCTGCCGCCGGTGA
 Primer design