SecReT6
Protein ID: 53723968
SecReT6 ID67
T6SS typeN/A
Gene symbol-
Locus tagBMA2826
StrainBurkholderia mallei ATCC 23344
Repliconchromosome I [GenBank: NC_006348] [Browse all T6SS(s) in this replicon]
Location [Strand]2913417..2917310 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ62G35
KEGG IDbma:BMA2826
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.60E-71, Aligned region: 64..107
ImcF-related_N [PF14331], Evalue: 1.60E-71, Aligned region: 189..445
IcmF-related [PF06761], Evalue: 1.60E-53, Aligned region: 494..861
DUF1215 [PF06744], Evalue: 1.80E-28, Aligned region: 993..1108
Protein Sequence: 1297 a.a.     [Download]
>gi|53723968|ref|YP_104340.1| hypothetical protein BMA2826 [Burkholderia mallei ATCC 23344]
MQRFLNVLTHPRTLTIVGFAALAAVLFIAADALQIGLVWAAVALGVALALWLATKLWRRWRVRRANRQLG
DMLEQQAETGKMSAAVAEPAKRAELDVLRTRLADTVKTIKTSKIGQVSGGSALYELPWYIVIGNPAAGKS
SAVINSGLQFPFADKNSAVIHGIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRSEWLGFLDLLKRYRPKA
PINGIIVTASIAELTGNRPEFAINLAKNLRQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSSNDRQE
YDRVWGATLPYEPDEKRDVVALFDQRFEELYDGLKEISVAQLSVSRGNKLSPGQLSFPLEFSTIKPALRS
FLATLFEDNPFQYKPIFRGFYFTSALQEGETNSAAAQRIAHRFGLDSQSLPKPHSAFSKNGFFLRDLFSK
VIFADRQTVRQFASPTKTRVRYATFFGFVAALALALGGWTWSTIGNQQLVSNVQADLDNVTRLQQNRNDL
QSRLQAMDILEDRIEQLEQFRRDKPLSVSLGLYQGNRLEQHLLTEYYNGVRQILLAPVSDNLASFLKDVN
AHPDQLAPMTRAPESGATPAGPMPVSTHPAAPGAAPSPAVAQGRQQGGLYNDASPTNVEDAYNALKTYLM
LSDKRHVEQAHLTDQVARFWRGWLETNRGNMPRDEMIRSAERMITFYLSRVSDNDWPMIEANLALVDQTR
ENLRRVVRGMPARQRVYEEIKARASTRFAPMTIARIVGEGNTGLVAGSYAIPGTFTRDAWFQYVQPAIRD
AATKELQAKDWVLNTASADDLTLEGSPEQIQKTLVAMYKTEYAQHWQKFMQGIAVQGFGNFTQAVDAMNK
LGDPQDSPIRKVLETAYDQTSWDNPSLANATIKKAQTGVVNWVKQWFTRQPGGQIAANVDINGNPADVPM
GPIGQEFVGLGRIVATHDGTSMLKGYMDTLSKVRTRFNVIKNQGDPGPGARQLMQQTLDGNGSELADSLK
FVDEQMLTGLTDSQRKSLRPLLVRPLMQAFAVVIQPASVEVNKVWNAQVYQPFQNSLANKYPFAAGAKVE
AGAGEIAQVFGPDGSIAKFVGTTLGPLAVRRGDTLSARTWGDMGLALTPDFTGGFARWVAPLAGGAATSA
AASSEPQTVFQVLPQPSSGTTEYTIAIDGQQLRYRNTPPQWTNFVWPNPQGSPGATLSATTFDGRTLQLV
NEPGRYGLEKLINSAQRKRRPDGTFDLTWTQGSVSVSVTMRIISTSQPTGGGDQPQQQSLRGLRLPSSVA
DASAGGAANATAQPGSGAAAAQVAATAASASNAQGAQ
 
Nucleotide Sequence: 3894 bp     [Download]
>gi|53723370|ref|NC_006348.1|:2913417-2917310 Burkholderia mallei ATCC 23344 chromosome 1, complete sequence
ATGCAACGCTTCCTCAACGTGTTGACTCACCCTCGCACGCTCACGATCGTCGGCTTCGCCGCGCTCGCGG
CGGTTCTGTTCATCGCGGCCGACGCGCTCCAGATCGGCCTCGTATGGGCGGCCGTCGCGCTCGGTGTCGC
GCTCGCGCTCTGGCTCGCGACGAAGCTCTGGCGCCGCTGGCGCGTGCGCCGCGCGAACCGCCAGCTCGGC
GACATGCTCGAGCAGCAGGCCGAAACGGGCAAGATGTCCGCCGCCGTGGCCGAGCCCGCGAAGCGCGCGG
AGCTCGACGTGCTGCGCACCCGCCTCGCCGACACGGTGAAGACGATCAAGACTTCGAAAATCGGCCAGGT
GTCGGGCGGCTCCGCGCTGTACGAACTGCCGTGGTACATCGTGATCGGCAATCCGGCCGCGGGCAAGAGC
AGCGCCGTCATCAACTCGGGGTTGCAGTTTCCGTTCGCGGACAAGAACAGCGCGGTGATCCACGGCATCG
GCGGCACGCGCAACTGCGACTGGTTCTTCACGACCGAAGGCATCCTGCTCGACACCGCGGGCCGCTATTC
GGTGCACGAGGAAGACCGCAGCGAATGGCTCGGCTTTCTCGATCTGCTCAAGCGCTATCGCCCGAAGGCC
CCGATTAACGGCATCATCGTGACGGCGAGCATCGCCGAGCTCACCGGCAATCGCCCCGAATTCGCGATCA
ACCTCGCGAAAAACCTGCGCCAGCGCGTGCAGGAGCTCACCGAGAAGCTCGAAGTGTTCGCGCCCGTCTA
CGTGATGTTCACGAAGGCCGACCTGATCACGGGCTTCACCGAATTCTTCAGCAGCAACGATCGCCAGGAA
TACGACCGCGTGTGGGGCGCGACGCTGCCGTACGAGCCTGACGAGAAGCGCGACGTGGTCGCGCTGTTCG
ATCAGCGCTTCGAGGAACTGTATGACGGGCTCAAGGAAATCAGCGTCGCGCAGCTGTCGGTGAGCCGCGG
CAACAAGCTCTCGCCCGGCCAGTTGAGCTTCCCGCTCGAATTTTCGACGATCAAGCCCGCGCTGCGCTCG
TTCCTCGCGACGCTGTTCGAGGACAACCCGTTCCAGTACAAGCCGATCTTCCGCGGCTTCTACTTCACGA
GCGCGCTGCAGGAAGGCGAAACGAACAGCGCGGCCGCGCAGCGGATCGCGCACCGCTTCGGGCTCGATTC
GCAAAGCCTGCCGAAGCCGCACAGCGCGTTCTCGAAGAACGGCTTCTTCCTGCGCGACCTGTTTTCGAAG
GTGATCTTCGCCGATCGCCAGACGGTCCGCCAGTTCGCGAGCCCGACGAAGACGCGCGTGCGCTACGCGA
CGTTCTTCGGCTTCGTCGCGGCGCTCGCGCTCGCGCTCGGCGGCTGGACCTGGTCGACGATCGGCAACCA
GCAGCTCGTCTCGAACGTGCAGGCCGACCTCGACAACGTGACCCGCCTGCAGCAGAACCGCAACGATCTG
CAATCTCGCCTGCAGGCGATGGACATCCTCGAGGATCGGATCGAGCAGCTCGAGCAGTTCCGGCGCGACA
AGCCGCTGTCCGTCTCGCTCGGCCTGTATCAGGGCAATCGGCTCGAGCAGCACCTGTTGACCGAGTACTA
CAACGGCGTGCGGCAGATCCTGCTCGCTCCCGTGTCGGACAATCTCGCGTCGTTCCTGAAGGACGTGAAC
GCGCATCCGGACCAGCTCGCGCCGATGACGCGCGCGCCCGAATCGGGCGCGACGCCGGCCGGCCCGATGC
CGGTATCGACCCATCCCGCGGCGCCGGGCGCGGCCCCCTCCCCCGCCGTCGCGCAGGGCCGGCAGCAGGG
CGGCCTCTATAACGACGCGTCGCCGACCAACGTCGAGGACGCGTACAACGCGCTGAAGACCTACCTGATG
CTCTCCGACAAGCGGCACGTCGAGCAGGCGCACCTGACCGATCAGGTCGCGCGCTTCTGGCGCGGCTGGC
TCGAGACGAATCGCGGCAACATGCCGCGCGACGAGATGATCAGGAGCGCGGAGCGAATGATCACGTTCTA
CCTGTCGCGCGTGTCCGACAACGACTGGCCGATGATCGAGGCGAATCTCGCGCTCGTCGACCAGACCCGC
GAGAACCTGCGCCGCGTCGTGCGCGGCATGCCGGCCCGCCAGCGCGTGTATGAAGAGATCAAGGCGCGCG
CGTCGACCCGCTTCGCGCCGATGACGATCGCGCGCATCGTCGGCGAAGGCAACACCGGCCTCGTCGCGGG
CAGCTACGCGATCCCCGGCACGTTCACGCGCGACGCGTGGTTCCAGTACGTGCAGCCGGCGATCCGCGAC
GCCGCGACGAAGGAGCTGCAGGCGAAGGATTGGGTGCTGAACACCGCGTCGGCGGACGATCTGACGCTCG
AGGGCAGCCCCGAGCAGATCCAGAAAACGCTCGTCGCGATGTACAAGACCGAGTACGCACAGCACTGGCA
GAAGTTCATGCAGGGCATCGCGGTGCAGGGCTTCGGCAATTTCACGCAGGCGGTCGACGCGATGAACAAG
CTCGGCGATCCGCAGGATTCGCCGATCCGCAAGGTGCTCGAGACCGCGTACGACCAGACCTCGTGGGACA
ACCCGTCGCTCGCGAACGCGACGATCAAGAAGGCGCAGACGGGCGTCGTGAACTGGGTCAAGCAGTGGTT
CACGCGCCAGCCGGGCGGCCAGATCGCGGCGAACGTCGACATCAACGGCAATCCCGCCGACGTGCCGATG
GGCCCGATCGGTCAGGAGTTCGTCGGGCTCGGCCGGATCGTCGCCACGCACGACGGCACGTCGATGCTCA
AGGGCTACATGGACACGCTGTCGAAGGTCCGTACGCGCTTTAACGTGATCAAGAACCAGGGCGACCCCGG
CCCCGGCGCGCGTCAGCTGATGCAGCAGACGCTCGACGGCAACGGCTCGGAGCTCGCCGATTCGCTGAAG
TTCGTCGACGAGCAGATGCTCACGGGCTTGACCGATTCGCAACGCAAATCGCTGCGCCCGCTTCTCGTGC
GCCCGCTGATGCAGGCGTTCGCGGTCGTGATCCAGCCGGCGAGCGTCGAGGTGAACAAGGTATGGAACGC
GCAGGTGTACCAGCCGTTCCAGAACTCGCTCGCGAACAAGTATCCGTTCGCGGCGGGCGCGAAGGTCGAG
GCGGGCGCGGGCGAGATCGCGCAGGTGTTCGGCCCCGACGGCTCGATCGCGAAGTTCGTCGGCACGACGC
TCGGCCCGCTCGCGGTGCGCCGCGGCGACACGCTGTCCGCGCGCACCTGGGGCGACATGGGCCTCGCGCT
CACGCCGGACTTCACGGGCGGCTTCGCGCGCTGGGTCGCGCCGCTCGCGGGCGGCGCGGCGACGAGCGCG
GCCGCGTCGTCCGAGCCGCAGACCGTGTTCCAGGTGCTGCCGCAGCCGAGCAGCGGCACGACCGAATACA
CGATCGCGATCGACGGCCAGCAGCTGCGCTACCGCAACACGCCGCCGCAATGGACGAACTTCGTGTGGCC
GAACCCGCAGGGCTCGCCCGGCGCGACGCTGTCCGCGACGACCTTCGACGGCCGCACGTTGCAGCTCGTC
AACGAGCCGGGCCGCTACGGCCTCGAGAAGCTGATCAACTCGGCGCAGCGCAAGCGCCGTCCGGACGGCA
CGTTCGATCTGACATGGACGCAGGGCAGCGTCAGCGTCTCGGTGACGATGCGCATCATCAGCACCTCGCA
GCCGACGGGCGGCGGCGATCAGCCGCAGCAGCAAAGCCTGCGCGGCCTGCGCCTGCCTTCGTCGGTCGCC
GACGCGAGCGCGGGCGGCGCGGCCAATGCGACGGCGCAACCCGGCTCGGGCGCCGCGGCCGCGCAGGTCG
CCGCCACGGCCGCTTCCGCATCGAACGCACAGGGGGCGCAATGA
 Primer design