SecReT6
Protein ID: 537437142
SecReT6 ID842
T6SS typei1
Gene symbol-
Locus tagSPUCDC_1889
StrainSalmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67
Repliconchromosome [GenBank: NC_022221] [Browse all T6SS(s) in this replicon]
Location [Strand]1882994..1883497 [+]
Producthypothetical protein
NoteTssB
UniProt IDT1YHB4
KEGG IDsega:SPUCDC_1889
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.90E-54, Aligned region: 7..163
Protein Sequence: 167 a.a.     [Download]
>gi|537437142|ref|YP_008481519.1| hypothetical protein SPUCDC_1889 [Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67]
MSKDYNGSVAPKERINISYIPKTDGEPSEVELPLNMLIVGDTGNSQETAPLDERQMVSIDKHSFNSVMAE
ASISLNFAVPASLKDDAKDGDEMNISLEIKSLNDFSPDSVAKQVPELNKLLELREALTALKGPLGNLPAF
RAQLQALLENEESREQLLREISQAENQ
 
Nucleotide Sequence: 504 bp     [Download]
>gi|537435369|ref|NC_022221.1|:1882994-1883497 Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67, complete genome
ATGAGCAAAGATTATAACGGCAGCGTGGCACCCAAAGAACGCATTAATATTTCTTACATTCCAAAAACGG
ACGGTGAGCCTTCTGAGGTGGAATTACCCCTTAATATGTTGATAGTGGGGGATACCGGAAACTCACAGGA
AACAGCGCCACTTGATGAACGCCAGATGGTTTCTATCGACAAACATTCATTCAATTCAGTGATGGCAGAA
GCGTCCATTAGCCTGAATTTTGCAGTTCCGGCATCATTGAAGGACGACGCAAAAGATGGCGATGAGATGA
ATATCTCGCTGGAAATCAAATCCCTGAACGATTTTTCTCCGGACAGCGTGGCAAAACAGGTACCGGAGTT
GAACAAATTGCTGGAACTACGCGAAGCGCTGACAGCATTAAAAGGCCCGCTCGGTAATCTGCCTGCATTT
CGCGCCCAGCTTCAGGCATTGCTGGAAAATGAAGAATCCCGCGAACAGTTACTGCGGGAGATCAGCCAGG
CAGAAAACCAGTAA
 Primer design