SecReT6
Protein ID: 537437143
SecReT6 ID842
T6SS typei1
Gene symbol-
Locus tagSPUCDC_1890
StrainSalmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67
Repliconchromosome [GenBank: NC_022221] [Browse all T6SS(s) in this replicon]
Location [Strand]1883527..1883739 [+]
Producthypothetical protein
NoteTssC
UniProt IDT1YIE7
KEGG IDsega:SPUCDC_1890
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 0.002, Aligned region: 36..68
Protein Sequence: 70 a.a.     [Download]
>gi|537437143|ref|YP_008481520.1| hypothetical protein SPUCDC_1890 [Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67]
MGLREETSRTDDAITQAVIRLFISQTGDINTETLEVLVAALDQRIGCLMDEIIHINGYQQMKPHWRKVFH
 
Nucleotide Sequence: 213 bp     [Download]
>gi|537435369|ref|NC_022221.1|:1883527-1883739 Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67, complete genome
ATGGGCTTGCGGGAAGAGACCTCCAGAACCGATGACGCAATAACGCAGGCAGTGATCCGGTTATTTATCA
GTCAGACAGGCGACATCAACACAGAAACACTGGAGGTATTGGTCGCGGCGCTTGACCAGAGGATCGGATG
TCTGATGGATGAAATCATCCATATCAACGGGTACCAGCAGATGAAGCCACACTGGCGAAAGGTGTTCCAC
TGA
 Primer design

Protein ID: 537437144
SecReT6 ID842
T6SS typei1
Gene symbol-
Locus tagSPUCDC_1891
StrainSalmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67
Repliconchromosome [GenBank: NC_022221] [Browse all T6SS(s) in this replicon]
Location [Strand]1883788..1885260 [+]
Producthypothetical protein
NoteTssC
UniProt IDT1YJ93
KEGG IDsega:SPUCDC_1891
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.70E-185, Aligned region: 68..489
Protein Sequence: 490 a.a.     [Download]
>gi|537437144|ref|YP_008481521.1| hypothetical protein SPUCDC_1891 [Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67]
MSLQEEELVSTRTEQGSHAPSLLDEIMAQTRIQPGADGYDIARQGVTAFIASLLQSTSPAEPVNKLAVDS
MIADIDARISRQMDAIIHAPQFQQLESFWRSMKALVDRVDFRENIKVHVLHVTKAELLEDFEFAPEITQS
GFYKHVYSSGLGQFGGEPIAAVLGAYEFKNTTPDMKLLNYVSAVGAMAHAPFLSSVSPEFMGLKSWTELP
NIKDLYAIFEGPAYTKWRALRDSEDSRYLGLTAPRFLLRQPYSATENPIKSFNYAEDVSHSHEHYLWGNT
AWMLASNIADSFAKYRWAPNIIGPQSGGAVKDLPVHLYESMGQIQAKIPTEVLITDRREFELAEEGFITL
TMRKNSDNAAFFSANSVQKPKHFPGKDAETNYKLGTQLPYLFIINRLAHYIKVLQREQLGSWKERSDLER
ELNIWVRQYVADQENPPADVRSRKPLRGAKVEVLDVDGEPGWYQVAISARPHFKYMGASFELSLVGRLDK
 
Nucleotide Sequence: 1473 bp     [Download]
>gi|537435369|ref|NC_022221.1|:1883788-1885260 Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67, complete genome
ATGTCTTTACAGGAAGAAGAACTTGTTTCCACCCGCACTGAACAGGGAAGCCATGCCCCGTCGTTGCTTG
ATGAAATCATGGCACAAACCCGTATCCAGCCCGGCGCTGACGGTTATGATATTGCCCGTCAGGGCGTAAC
GGCTTTTATTGCCAGCCTCCTGCAATCCACTTCACCTGCAGAACCCGTAAACAAACTGGCCGTGGACAGC
ATGATTGCGGACATCGACGCCCGTATCAGCCGTCAGATGGATGCTATTATTCACGCCCCTCAGTTTCAGC
AACTGGAGTCGTTCTGGCGTTCAATGAAAGCGCTGGTCGATCGCGTTGATTTTCGTGAGAATATTAAGGT
GCATGTCCTCCATGTCACCAAAGCGGAATTGCTGGAAGATTTCGAGTTCGCGCCGGAGATTACCCAGTCC
GGCTTCTATAAGCATGTTTATTCCAGCGGGCTTGGGCAGTTTGGCGGCGAACCGATTGCGGCTGTGCTGG
GCGCATATGAGTTCAAAAATACCACGCCGGATATGAAGCTGCTGAACTATGTCAGCGCCGTCGGCGCAAT
GGCTCACGCGCCGTTCCTTTCTTCCGTGTCGCCGGAGTTTATGGGCCTGAAATCATGGACCGAGCTGCCC
AATATCAAGGATCTCTACGCCATTTTTGAAGGTCCGGCCTACACAAAATGGCGCGCCCTGCGTGATTCCG
AAGATTCCCGCTACCTGGGACTGACCGCGCCGCGTTTTCTGCTTCGCCAGCCCTATTCCGCGACCGAAAA
CCCGATTAAAAGCTTCAACTACGCCGAAGATGTGAGCCACAGCCACGAGCATTATTTGTGGGGCAATACC
GCCTGGATGCTGGCCAGTAATATAGCCGATTCGTTCGCGAAATACCGGTGGGCGCCCAATATTATCGGGC
CGCAGAGCGGCGGCGCAGTAAAAGATCTGCCGGTACATTTATATGAGTCAATGGGGCAGATTCAGGCCAA
GATCCCGACGGAGGTGTTGATCACCGACCGCCGTGAGTTCGAGCTGGCCGAAGAGGGGTTCATCACCCTG
ACCATGCGTAAAAACAGCGATAATGCGGCGTTTTTCTCGGCTAACAGCGTTCAGAAACCCAAGCATTTTC
CGGGCAAAGACGCCGAGACCAACTACAAGCTGGGTACGCAGTTGCCTTATCTGTTCATTATTAACCGCCT
CGCGCACTACATTAAGGTGCTGCAACGCGAGCAGCTTGGGTCGTGGAAAGAGAGAAGCGATCTGGAGCGG
GAGCTGAATATTTGGGTGCGCCAGTATGTCGCCGATCAGGAGAATCCGCCTGCTGATGTCCGCAGCCGTA
AGCCGCTGCGTGGCGCTAAAGTGGAGGTGCTGGATGTGGACGGCGAGCCGGGCTGGTATCAGGTGGCGAT
TTCCGCAAGGCCGCACTTTAAATATATGGGCGCGTCGTTTGAATTGTCTTTAGTCGGACGGTTAGATAAG
TGA
 Primer design