SecReT6
Protein ID: 537437145
SecReT6 ID842
T6SS typei1
Gene symbol-
Locus tagSPUCDC_1892
StrainSalmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67
Repliconchromosome [GenBank: NC_022221] [Browse all T6SS(s) in this replicon]
Location [Strand]1885257..1885673 [+]
Producthypothetical protein
NoteTssE
UniProt IDT1YK18
KEGG IDsega:SPUCDC_1892
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.70E-15, Aligned region: 32..115
Protein Sequence: 138 a.a.     [Download]
>gi|537437145|ref|YP_008481522.1| hypothetical protein SPUCDC_1892 [Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67]
MIPAREKPAGSLFERLENPPARNWREGSNIEAFRQSIRHSLRNILNTRSGSCRGTPGLGIEEPEGSDNYR
SAMSQAIVQCIERYEPRISHAEVRAILPQAASPQEIIFRITAWVTFNDIDDVLEFDMAPDGSQHYRVE
 
Nucleotide Sequence: 417 bp     [Download]
>gi|537435369|ref|NC_022221.1|:1885257-1885673 Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67, complete genome
GTGATACCGGCGCGCGAAAAGCCTGCCGGATCGCTGTTTGAGCGTCTGGAAAACCCTCCTGCCAGAAACT
GGCGGGAGGGCAGTAATATAGAGGCGTTCAGGCAGTCCATTCGCCATAGTCTGCGCAATATCCTGAACAC
CCGCTCCGGCAGTTGTCGGGGAACACCGGGGCTGGGTATTGAAGAGCCGGAAGGGTCGGATAATTACCGC
AGCGCCATGAGCCAGGCCATCGTGCAGTGTATTGAGCGTTATGAACCCCGGATTTCGCACGCGGAGGTCC
GGGCAATCCTGCCACAGGCCGCCAGCCCACAGGAGATAATTTTTCGTATCACCGCCTGGGTGACATTTAA
CGATATCGACGATGTGCTGGAGTTTGATATGGCACCGGACGGTAGTCAGCATTATCGGGTGGAGTAG
 Primer design